KEGG   Mycobacterium ulcerans: MUL_0817
Entry
MUL_0817          CDS       T00435                                 

Definition
(GenBank) O-methyltransferase
Organism
mul  Mycobacterium ulcerans
SSDB
Motif
Pfam: LCM
Other DBs
NCBI-ProteinID: ABL03457
Pasteur: MUL_0817
UniProt: A0PM88
Position
complement(855518..856420)
AA seq 300 aa
MNRRTDADSWDPASSVGATATMVAASRARASRGPDALLDDRLAGPLVRAVGLQPLVRMID
GDTAVDDPPSSPRSLNEQIAVRTRYFDDFFTAAGAGGIRQAVILASGLDTRAYRLNWPSG
MTVYEIDQPQVIEFKTRTLAEFGALPCPDHRPIGIDLREDWPSALRQRGFDAGQPTAWIA
EGLLVYLPPEAQDRLFDNIAELSTPRSQVATEHFPDPNGFSGPRAQRLSERWHRMGMDLD
MAELIYHGDRNTVIDYLADHGWRVRARTFEEMHAHNGFEPPDDEMMALFGGMSYVTGIRK
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaaccggcggacggacgcggacagctgggatccggcgtccagcgtgggagcgacggcg
acgatggtcgcggcttcgcgggcacgggcctcccggggacccgatgcgctgctcgacgac
cggctcgccgggccgctcgtccgtgcggtggggctgcagccgttggttcgcatgatcgat
ggtgacaccgcggtcgacgatccgccgtcaagcccccggtcgctaaacgaacagatcgcg
gtgcgcaccaggtatttcgatgacttcttcactgctgccggtgcgggcggtatccgccag
gcggtgatcctggcgtcaggtctggacaccagggcttaccgattgaactggccatcgggc
atgacggtctacgaaattgaccaaccgcaagtgatcgagttcaagacgcgcacgctggcc
gagttcggcgcactcccctgccccgaccatcggccaatcggtatcgacctgcgcgaggat
tggccgagcgcgctgcggcagcgcggtttcgacgccgggcaaccgaccgcatggatcgcc
gagggcctgctggtctatttgccgcccgaggcccaggatcggctgttcgacaacatcgcc
gagctcagcacgccgcgaagccaggtcgccaccgagcacttccccgaccccaacggcttc
tccgggccgcgcgcacagcggctttccgaacgctggcaccggatggggatggatctggac
atggccgagctgatctaccatggcgaccgcaacaccgtcatcgactaccttgccgaccac
ggatggcgggtgcgggcccgaacgtttgaagagatgcacgcacacaatgggtttgagccg
cccgacgatgagatgatggcgctgttcggcgggatgagctacgtcaccgggatccgcaag
tag

DBGET integrated database retrieval system