KEGG   Mycobacterium ulcerans: MUL_0921
Entry
MUL_0921          CDS       T00435                                 

Gene name
otsB2
Definition
(GenBank) trehalose-6-phosphate phosphatase OtsB2
  KO
K01087  trehalose 6-phosphate phosphatase [EC:3.1.3.12]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00500  Starch and sucrose metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MUL_0921 (otsB2)
Enzymes [BR:mul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     MUL_0921 (otsB2)
SSDB
Motif
Pfam: Trehalose_PPase Hydrolase_3
Other DBs
NCBI-ProteinID: ABL03549
Pasteur: MUL_0921
UniProt: A0PMI0
Position
complement(965008..966180)
AA seq 390 aa
MSVTIDPRRHDAVLFDTALNSTQALVRQLQQARVGTATFASGGGGHDAAIQALIESADRV
GARPGRCVVITADAASVAAARDSGFALVIGVDQAGHRDALPDHGADTVLADLDEVRVRAG
DRHMSELPDALQALGRPDGLTVPRPAVFFDFDGTLSEIVDDPDAATPTAGAVAALQQLAA
QCPVAILSGRDLADVSQRVGLPGIWYAGSHGFELTAPDGTHHQNEAAAAAIPVLEQAAAQ
LRDRLGSIPGVMVEHKRFGVATHYRNAARNRVGKIAAVVRAAGQRDGLRVTTGREVIELH
PDIDWDKGKTLRWVIDHLPDQRAAPLVPIYLGDDITDEDAFDAVGPNGVAIMVRHNEDGD
RATAALFALESPARVAEFTGRLASQLSTLG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtcggtcaccatcgacccgcgccgccatgatgccgtcttgttcgacaccgcattgaac
tcgacacaagcactggtccggcaacttcagcaagcccgcgtcggcaccgccacctttgcc
tccggcggtggcgggcacgacgccgcgatccaggccctgatcgaatcggccgaccgcgtc
ggcgcgcggcccggccgctgcgtggtcatcaccgcagacgcggcgagcgtagccgccgcc
cgcgacagcggattcgcgctggtgatcggggtggaccaggccgggcaccgcgacgcgcta
cctgaccacggcgccgacaccgtcctcgccgatctggacgaagtgcgggtgcgcgccggc
gaccggcacatgtccgagcttcccgacgcattgcaggcactcggacgacccgacggcctg
accgtgccgcggcccgcggtcttcttcgatttcgatggcacgttgtccgagatcgtcgac
gatccggatgcggccacgccgacggccggcgccgtggcggcactgcaacagttggccgcg
cagtgtccggtagcgatactcagcggccgcgacctcgccgacgtatcccaacgcgtggga
ctgcccggaatctggtatgcgggcagtcatgggttcgagctgaccgcgccggacggaacg
catcaccagaacgaggccgccgcggcggcgataccggtgctcgaacaggcggccgcccag
cttcgcgaccggctcgggtccatccccggggtgatggtggagcacaagcggttcggcgtg
gccacccactaccgcaatgccgcccgcaaccgggtgggcaagatcgctgcggtggtgcgt
gccgcgggccagcgcgacgggctgcgggtgacgaccggccgcgaggtgatcgaactgcac
ccggacatcgactgggacaagggcaagacgctgcgctgggtaatcgatcacctgcctgat
cagcgggccgctcccctggtgccgatctatctcggtgacgacatcaccgacgaggacgcg
ttcgacgcggtaggccccaatggcgttgcgatcatggtgcggcacaacgaagatggcgat
cgcgccaccgccgcactgttcgcgctcgagagtccggctcgggttgccgagttcaccgga
cggctggcgagccagctgtcgacgcttgggtga

DBGET integrated database retrieval system