KEGG   Mycobacterium ulcerans: MUL_2114Help
Entry
MUL_2114          CDS       T00435                                 

Gene name
cysG
Definition
(GenBank) multifunctional enzyme siroheme synthase CysG
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00860  Porphyrin and chlorophyll metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
Module
mul_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUL_2114 (cysG)
Enzymes [BR:mul01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     MUL_2114 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MUL_2114 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     MUL_2114 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABL04535
Pasteur: MUL_2114
UniProt: A0PQB6
Position
2361128..2362333
Genome map
AA seq 401 aa AA seqDB search
MTESPYLVGLRLTGRKVVVVGGGTVAQRRLPLLIASGADVQVISRSATRSVEVMDKITLT
LREYRDGDLEGAWYAIAATDDPAVNAAIVAEADRRQIFCVRADIAVEGTAVTPATFNHAG
LSVGVLASGDHRRSAAIRSAIREALQNGLVTSTSYQSSDVIRGGVALIGGGPGDPELITV
RGRRLLAQADVVVADRLAPPELLAELPPHVEVIDAAKIPYGRAMAQDAINDVMIERAKAG
RFVVRLKGGDPFVFARGYEEVLACTEAGIPVIVVPGVTSAIAVPALAGVPVTHRATNHEF
VVVSGHIAPDHPESLVNWNALAAMSGTIVLLMAVERIELFVEALLKGGRPAYTPVLVVQH
GTTPAQHTLRATLADTPEKVRAEGIRPPAIIVIGAVATFGV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagagcccctaccttgtcggactgcgtctgaccggcaggaaggtcgtcgtggtc
ggcgggggcaccgttgctcagcgccgtctgccccttctgatcgccagcggcgcggatgtg
caagtcatatcccgtagcgccacccgttctgtcgaggtgatggacaagatcaccttgacc
ctgcgggaatatcgcgacggcgacttggaaggcgcctggtacgcgatagcggccaccgat
gaccccgcggtgaacgcggccatcgtcgccgaagccgatcggcgccagattttctgcgtg
cgcgccgacatcgccgtggaaggaaccgcggtcacccccgcgaccttcaaccacgcgggc
ctgtcggtgggagtcttggccagtggcgaccaccgtcgttcggcggcaatccggtcggcg
attcgcgaggcgctgcagaacggccttgtcacctcgacgagctatcagagttccgacgtc
atccggggcggggtcgcgctgatcggcggcggtccgggggatccggagctgatcaccgtc
cggggtcgacgcctgctcgcccaggcggatgtcgtcgtcgccgaccggctcgcgccacct
gaactgctcgccgaactgccgccgcacgtggaagtcatcgacgcggccaagatcccttac
ggccgggccatggcccaggacgccatcaacgacgtcatgatcgagcgggccaaggcgggg
cgctttgtcgtccgcctcaaagggggcgacccgttcgtcttcgcgcggggctatgaagag
gtgttggcatgcaccgaagccgggattccggtgattgtggttccaggtgtgacgagtgcc
atagctgtgcccgctttggcgggcgttccggtcactcatcgggccacgaatcacgagttt
gtggtggtcagcggccatatcgcgcccgaccatcccgaatcgttagtgaattggaatgcg
ttggcagcaatgtcaggcacgattgttttgctgatggcggtcgaacgaatcgaacttttc
gtcgaggcgctgttgaaaggcggccgacctgcgtatacgccggtgcttgtcgttcagcat
ggaacgacgcccgctcagcacacgttgcgggcgacccttgccgacacgccggaaaaggtc
cgcgcggaggggatccgacctcctgcgatcatcgtcataggggctgtcgcgacattcggg
gtttaa

DBGET integrated database retrieval system