KEGG   Mycobacterium ulcerans: MUL_3008Help
Entry
MUL_3008          CDS       T00435                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00071  Fatty acid degradation
mul00072  Synthesis and degradation of ketone bodies
mul00280  Valine, leucine and isoleucine degradation
mul00310  Lysine degradation
mul00362  Benzoate degradation
mul00380  Tryptophan metabolism
mul00620  Pyruvate metabolism
mul00630  Glyoxylate and dicarboxylate metabolism
mul00640  Propanoate metabolism
mul00650  Butanoate metabolism
mul00900  Terpenoid backbone biosynthesis
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01200  Carbon metabolism
mul01212  Fatty acid metabolism
mul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_3008
   00630 Glyoxylate and dicarboxylate metabolism
    MUL_3008
   00640 Propanoate metabolism
    MUL_3008
   00650 Butanoate metabolism
    MUL_3008
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MUL_3008
   00072 Synthesis and degradation of ketone bodies
    MUL_3008
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MUL_3008
   00310 Lysine degradation
    MUL_3008
   00380 Tryptophan metabolism
    MUL_3008
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUL_3008
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MUL_3008
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MUL_3008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mul04147]
    MUL_3008
Enzymes [BR:mul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MUL_3008
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUL_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABL05261
Pasteur: MUL_3008
UniProt: A0PSE2
Position
complement(3330388..3331872)
Genome map
AA seq 494 aa AA seqDB search
MAVDPRTPVLIGYGQVNYRDEIDPTMPSVEPVDLMLAAAQQAADSRVLAAVDSMRVVRVL
SAHYRNPGQLLGERLQASGFTTSYSSVGGNTPQPLVSQACLDVQRGRAGVVLIAGAETWR
TRTGLKSKGARLTWTLQDESVPLPRVAGQDVPMAGESEIRIKLDRAAYVYPMFEQALRIA
NGESIEDHRSRVGRLWAGFNAVAVDNPHAWIRTPMTAEQICRPGPQNRMISWPYTKLMNS
NNMVDQGAALILTSVEQATRLRVPTERWVYPQTGTEAHDTFSSAERAELHQSPAIRIAGA
RALELAGLGINDADYVDLYSCFPSAVQVAAHELGLPVDDADRPLTVTGGLTFAGGPWDNY
VTHSIATMAELLAANPGRRGLITANGGYLTQHSIGVYGTEPPAEFRWEDVQPLVDREPTR
AALVGWDGVGAVEAWTTPFTRDGQPEKAFVAVRTPTGARTLGVITDPASAHATVHEDIAG
AKVAIAADGNATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccgtagacccccgcacgccggtgctgatcggctacggccaggtcaactaccgcgat
gaaatcgaccccaccatgccgtcggtcgagcctgtcgatctgatgctcgccgcggcgcag
caggcggccgattcccgggtgctcgcggccgttgactccatgcgcgtggtccgcgtgctc
tcggcgcactaccgcaatcccggccagttgcttggcgagcggctgcaggccagtggtttc
accaccagctacagcagcgtcggcggcaacacaccgcagcctctggtcagccaggcgtgc
ctggacgtacagcggggtcgagccggggtggtgttgatcgctggcgccgagacgtggcgg
accaggaccggtctgaagtccaagggcgcccgactgacctggacgcttcaggacgaatcc
gttccgctgccgcgggtcgccggccaggatgtgccgatggccggcgagagcgaaatcaga
atcaagctggatcgggccgcctacgtctatccgatgttcgagcaggcgctacgcatcgcc
aacggcgagtcaatcgaggaccaccgcagcagagtcggccgactgtgggcggggttcaac
gcggtcgcggtggataacccgcacgcctggatccgcaccccgatgactgccgaacagatt
tgtcggcccggcccgcagaaccggatgatcagctggccctacaccaagctgatgaactcc
aacaacatggttgaccagggcgccgccctgatcctcacgtcggtcgagcaggcgacacgg
ctgcgggtgcccaccgaacgctgggtctacccgcagaccgggaccgaggcgcacgacacc
ttctcgagtgccgagcgcgccgagctgcaccagtcgccggccatccgaattgccggggca
cgcgcgttggaactcgccggtctgggcatcaacgatgccgactacgtcgacctgtactcg
tgtttcccgtccgcggtgcaggttgccgcacacgaactcgggctgcctgtcgacgatgcc
gaccggccgttgaccgtcaccggcggactgacctttgccgggggcccgtgggacaactac
gtcacacattcgattgccaccatggccgagttattggcggccaaccccggccggcgcggg
ctgatcaccgccaacggcggctacctgacccagcacagcatcggcgtgtacggcaccgag
ccacccgcggagttccgctgggaagacgtgcaaccgctggtggaccgcgagcccacccgg
gccgccctggtcggatgggacggcgtcggcgccgtcgaggcctggacaacgcccttcacc
agagacgggcaacccgagaaggccttcgtcgccgtgcgcacgcccaccggggcgcgtacc
ttaggcgtgatcaccgatcccgcatcggcccatgccaccgtgcatgaggacatcgccggg
gcaaaggttgccatcgctgccgatggcaacgcgacattgcggtaa

DBGET integrated database retrieval system