KEGG   Mycobacterium ulcerans: MUL_3204Help
Entry
MUL_3204          CDS       T00435                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00010  Glycolysis / Gluconeogenesis
mul00052  Galactose metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
Module
mul_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_3204
   00052 Galactose metabolism
    MUL_3204
Enzymes [BR:mul01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MUL_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABL05421
Pasteur: MUL_3204
UniProt: A0PSV2
Position
complement(3572873..3573919)
Genome map
AA seq 348 aa AA seqDB search
MKVDATPVSRYTLNSGRGMRVRILTYGGIIQSIEVPDRTGRIGNVVLGFPTLAGYLNNTG
SAKTYFGAIIGRYGNRIAGGVFALDGHEYHLPVNDGGNSLHGGTAGFDTKVWQASVEKGG
DSVGLKLHYVSPAGEMGFPGALSTTVTYTLDQNNQLRINYHASTDAPTVINLTNHSYFNL
AGEDALDVYGHKVTIHADNYTPIDSTLIPTGQITAVRGTPFDFTSPTAIGAHITDNDPQL
LLAHGYDHNWVINRADNTELIEAARVQDPQTGRTLTVSTTEPGVQFYTSNFINATFTGTS
GHIYRQGAGFTMETQHYPASPNHPGFPSTELTPGQTYDSTTVFGFGAE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgatgcgaccccggtgagccgctacacgctcaacagcgggcgcggaatgcgg
gtgcgaatcctgacttacggcggcatcatccagtcgatcgaagtccccgatcgcaccgga
cgtatcggcaatgtggtgctgggctttccgaccctggccggctacctgaacaacaccgga
tccgccaagacctatttcggcgcgatcatcggccgctacggcaaccggatcgccggggga
gtcttcgcgctcgacggccacgagtatcacctgcccgtcaacgacggcggtaacagcctg
cacggcggcaccgccggattcgataccaaggtgtggcaggccagtgtggaaaaaggcggt
gacagcgtgggtttgaagctccactatgtcagtcccgcaggagaaatgggctttcccggg
gcactgagtacaacggtcacctacaccctggatcagaacaatcaactgcgcatcaactac
cacgccagcaccgacgcgccgaccgtgatcaacctgaccaatcacagctacttcaacctg
gccggtgaggacgcacttgacgtctacggccacaaggtcaccatccatgccgacaactac
acgccaatcgactccaccctgatcccgaccgggcagatcaccgcggtgcggggcacgccg
ttcgatttcacctcaccgaccgcgatcggcgcgcacatcaccgacaatgacccgcaactg
ttgctggcccacggctatgaccacaactgggtgatcaaccgcgccgacaacaccgaattg
atcgaggcggcccgggtgcaggatccacaaacggggcgcaccctgaccgtctccaccacc
gagcccggcgtgcagttctacacatccaacttcatcaacgcgacgttcaccggcaccagc
gggcatatctaccgccaaggcgcgggattcacgatggagacccagcactacccggcttcg
ccgaatcaccccggcttcccgagcaccgagctcaccccgggtcagacctacgactcgaca
acggttttcggcttcggcgccgaatag

DBGET integrated database retrieval system