KEGG   Mycobacterium ulcerans: MUL_3908Help
Entry
MUL_3908          CDS       T00435                                 

Gene name
rphA
Definition
(GenBank) ribonuclease RphA
  KO
K00989  ribonuclease PH [EC:2.7.7.56]
Organism
mul  Mycobacterium ulcerans
Brite
KEGG Orthology (KO) [BR:mul00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mul03016]
    MUL_3908 (rphA)
Enzymes [BR:mul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.56  tRNA nucleotidyltransferase
     MUL_3908 (rphA)
Transfer RNA biogenesis [BR:mul03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    MUL_3908 (rphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C COXG
Motif
Other DBs
NCBI-ProteinID: ABL05979
Pasteur: MUL_3908
UniProt: A0PUG0
Position
complement(4364899..4365678)
Genome map
AA seq 259 aa AA seqDB search
MSKREDGRRDDELRPVVITRGFTENPAGSVLIEFGRTKVMCTASVTEGVSRWRKGSGLGW
LTAEYAMLPSATHTRSDRESVKGRVGGRTQEISRLVGRSLRACIDLAALGENTIAVDCDV
LQADGGTRTAAITGAYVALADAVNYLAAAGKLSDPRPLSCAIAAVSVGVVDGRVRVDLPY
EEDSRAEVDMNVVATDTGTLVEVQGTGEGATFPRSTLDKLLDMALGACDTLFAAQCDALA
LPYPGVLPEGPPPSKAFGS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaacgagaagacggccgccgcgacgacgagcttcgcccagtggtcatcacccga
gggttcaccgaaaaccccgcgggttcggtactgatcgaattcggtcgcaccaaggtgatg
tgcacggccagcgtcaccgaaggcgtgtcgcgctggcgcaaggggtccgggctggggtgg
ctcaccgcggaatacgcgatgctgccgtcggcaacccacacccgctcagaccgggaatcg
gtgaaagggcgggtcggcggacgcacccaggagatcagccggctggtcggccggtcgctg
cgggcatgcatcgacttggcggcgctgggggagaacaccatcgctgtcgactgtgacgtg
ttgcaggcggacggcggcacccgtaccgcggccatcaccggtgcctacgtggcactggca
gacgcggtgaactacttggcggcggccggcaagctgtcggatccgaggccgttgtcctgc
gccatcgctgcggtcagcgtgggggtggtcgatggccgggttcgggtggacctgccttac
gaggaagactcccgcgccgaggtcgacatgaatgtcgttgccaccgacaccgggacgctg
gttgaagtgcagggcaccggtgagggtgcgacgttcccgcggtcgaccttggacaagctg
ctggacatggcgctgggggcatgcgacacgttgtttgccgcccagtgtgatgccttggcg
ctgccgtacccgggtgtattgcccgaagggccgccgccgtcgaaagcgttcggaagctga

DBGET integrated database retrieval system