KEGG   Mycobacterium ulcerans: MUL_4558Help
Entry
MUL_4558          CDS       T00435                                 

Gene name
gpm1
Definition
(GenBank) phosphoglycerate mutase 1 Gpm1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mul  Mycobacterium ulcerans
Pathway
mul00010  Glycolysis / Gluconeogenesis
mul00260  Glycine, serine and threonine metabolism
mul00680  Methane metabolism
mul01100  Metabolic pathways
mul01110  Biosynthesis of secondary metabolites
mul01120  Microbial metabolism in diverse environments
mul01130  Biosynthesis of antibiotics
mul01200  Carbon metabolism
mul01230  Biosynthesis of amino acids
Module
mul_M00002  Glycolysis, core module involving three-carbon compounds
mul_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUL_4558 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    MUL_4558 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUL_4558 (gpm1)
Enzymes [BR:mul01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MUL_4558 (gpm1)
Membrane trafficking [BR:mul04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MUL_4558 (gpm1)
Exosome [BR:mul04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MUL_4558 (gpm1)
  Exosomal proteins of melanoma cells
   MUL_4558 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABL06512
Pasteur: MUL_4558
UniProt: A0PVZ3
Position
5057717..5058472
Genome map
AA seq 251 aa AA seqDB search
MGDTGTLVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPLIEKGSEFSQDADPRYANIDGGPLTECLADVVARFLPYFTDVIVGDLRAGKTVLI
VAHGNSLRALVKHLDQMSDEDIVGLNIPTGIPLRYDLDERLQPVVPGGTYLDPEAAAAGA
AAVASQGAAKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaccgggacgttggtgctgcttcgccatggcgagagcgactggaacgctcgc
aacctgttcaccggctgggtcgacgtcggcctgaccgagaagggccgggccgaggcggta
cgaagcggcgaattgctggccgaacaggatctgctgcccgatgtgctctacacctcgctg
ttgcggcgcgcgatcaccactgcgcatctggcgctggacagcgccgaccggctgtggatt
ccggtgcggcgcagctggcggctcaacgaacgtcactacggggcgctgcaggggctggac
aaagccgagaccaaggcccgctacggcgaagagcagttcatggcctggcggcgcagctat
gacactccaccgccactaatcgagaagggcagtgagttcagccaggacgctgacccccgc
tacgccaacattgacggcgggccgctgaccgaatgcctggctgacgtggtggcccggttt
ctgccctacttcaccgacgtcatcgtcggtgacctgcgggccggcaagacggtgttgatc
gtcgcgcacggcaactcgctgcgcgcgttggtcaagcatctggaccagatgtccgatgag
gacatcgtcggactcaacatcccgacgggcattccgctgcgctacgacctggacgaacgg
ctgcaaccggtggtgcccgggggtacctatctggacccggaggcggccgccgcgggggct
gccgcggtggcgagtcaaggcgcggcaaaagcctga

DBGET integrated database retrieval system