KEGG   Massilia umbonata: FCL38_04945
Entry
FCL38_04945       CDS       T06138                                 

Definition
(GenBank) TolC family protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
mum  Massilia umbonata
Brite
KEGG Orthology (KO) [BR:mum00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mum02000]
    FCL38_04945
Transporters [BR:mum02000]
 Other transporters
  Pores ion channels [TC:1]
   FCL38_04945
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: QCP09841
UniProt: A0A4V1ED49
Position
complement(1194176..1195414)
AA seq 412 aa
MRVFRLHLFHLPIFLAAAALLQPLPAMAEPAAPTLRALVDNAWQRSPLARTLEARQDEAA
AARDLSRSWLAAAPTLGLSDRSDRWTDQRNQRETEVTIAAPIVLPGQHAARQALAARGSE
ESASLVARARLTIAGEVRQRLWEAAAAREALAEKSDHLHHLEELRDEVQRRVKSGDLARS
DGLLAEQEVLAAQADVALARMRAGEALARFRILTGSAELPALQPELLPDLLPEQPATEHV
RLRAAQAGEQRARAALELAAASVNGAPTVALSMRRERDTNLAAADRSIGIAVQIPLGSRM
RNRPAETLAATQVATAAAEKAEAQSVIESDILLAREQLEIARQALDLALARATTMREHTA
LFDKAFTLGERGLAELLRSRALTHEAEVAVRQQRIAVGLAHAQLNQAFGVLP
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcgcgtttttcgcctgcacctgtttcacctgcccatatttcttgccgcagcggcgctg
ttacagccgctgccggcaatggcggaacctgccgcacccaccctgcgcgccctcgtcgac
aacgcctggcagcgctcgcccctcgcccggacgctcgaggcacgccaggacgaagccgcc
gcggcgcgcgacctgtcgcggtcctggcttgccgccgcgccgacccttgggctgtcggac
cggtccgaccgctggacagaccagcgtaatcaacgcgaaaccgaagtaacgattgccgcg
ccgatcgtcctgccaggccagcacgctgcgcgccaggcccttgccgcacgcggttcggag
gaatccgcctccctggtcgcccgtgccaggctgaccatcgccggcgaagtcaggcagcgc
ctgtgggaggcggccgccgcacgcgaggcgctggcggagaagagcgaccacctgcatcac
ctcgaggaacttcgcgatgaagtgcagcggcgcgtcaagtccggcgacctggcccgcagc
gatggcttgctggccgagcaggaagtactggccgcgcaggcggatgtcgcgctggcccgc
atgcgtgcgggcgaggcgctggctcgctttcgcatcctgaccggcagcgcggaactgccc
gcgctgcagcccgaactgctgcccgatctgctgccggaacagccggcgacagaacacgtg
cgcttgcgcgccgcgcaggctggcgaacagcgcgccagggccgccctggagctggccgcg
gccagcgtgaacggtgcgccgacggtggccctgtccatgcgccgtgagcgcgacaccaat
ctggccgccgccgaccgcagcatcggtatcgcggtgcagatcccgcttggcagcaggatg
cgcaaccgtccggccgagacactggctgcgacgcaggtcgcgactgccgccgcggaaaag
gcggaagcccagagcgtgatcgagagcgacatcctgctcgcccgggaacagctggagatc
gccaggcaagcgctcgaccttgccctggcgcgcgccacgacgatgcgcgagcacaccgcg
ctgttcgacaaagctttcacgctgggtgaacgcggcctggccgaactgctgcgctcccgc
gccttgacccacgaagcagaagtcgcggtgcggcagcagcgcatcgccgtcggccttgcg
catgcccaactgaatcaagcatttggagtcctcccatga

DBGET integrated database retrieval system