KEGG   Massilia umbonata: FCL38_12190Help
Entry
FCL38_12190       CDS       T06138                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
mum  Massilia umbonata
Pathway
mum00460  Cyanoamino acid metabolism
mum00500  Starch and sucrose metabolism
mum01100  Metabolic pathways
mum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FCL38_12190
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    FCL38_12190
Enzymes [BR:mum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     FCL38_12190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: QCP11085
UniProt: A0A4P8HRU6
Position
complement(2988458..2990698)
Genome map
AA seq 746 aa AA seqDB search
MKRNAAILLALAALPCLAVAAAADAARPWLDPSLDPDRRAALVLKEMTQKEKLKWVSSHF
GADHAGNKTKKVPEAIPFSAGYVPPLDRLGLPALFLTDAGIGVATQNTTTPRERTALPSG
IATAATWNRKLAYEGGRMIGAEARASGFNVMLAGGMNLLREPRNGRNFEYGGEDPLLAGV
MVAEQVRGIESNHVISTIKHYALNAQETGRFELDARIDPAALRMSDLFAFQVALEMTDAG
SFMCAYNRLNGPYGCEHPWLLNGVLKGDWGYKGFVMSDWGATHSTVEAANAGLDQQSGFE
FDRSHYFGGALEEAVESGFVPQKRLDDMVLRVLRTMFAKGVVDHPVKQDGAIDYEAHGRI
SQADAEEGIVLLKNSGNLLPLAKDVRKIVVIGGHADKGVLAGGGSSLVYPRGGNAVPGLL
PATWPGPIMYYPSSPLKAIQARVPGAQVVFDSGTDPAKAAAAAAGADVVLVFATQWVGEA
LDATSLALPDNQDALIAAVAAANPKTAVVLENSGPVLMPWVDRVAGIVEAWYPGTNGGEA
IARVLFGEVNPSGRLPATFPASEQQLPRPKLDGDPAKPDERFTVDYHEGAAVGYKWFDLK
GHKPLFPFGHGLSYTQFGYKDLKAQLVDGKVQVRFTVTNTGSVAGKDVPQVYVSPLSARW
EAPKRLAGWDKVELAPGASTNVTLAIDPRLFGMVKGSANTWHVAGGRYQVKLARHALDDA
AQTVTIQLPAQVLDVAGRPMTKKTKG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaacgcagcaatcctgctggcgctggccgcattgccgtgcctggccgtggcc
gcggccgccgatgccgcccggccgtggctggaccccagcctggaccccgaccggcgcgcc
gcgctggtcctgaaggaaatgacgcagaaggaaaagctgaagtgggtatcgagccacttc
ggcgcggaccatgccggcaacaagacgaaaaaggtgcccgaggcgatcccgttctcggcc
ggctacgtgccgccgctggaccgcctgggcctgccggcactgttcctgaccgatgccggg
atcggcgtggccacgcagaacacgaccacgccgcgcgagcgcaccgcgctcccttccggc
atcgccacggcagccacgtggaaccgcaagctggcctatgaagggggccgcatgatcggc
gccgaggcgcgtgcttccggcttcaacgtgatgctggccggcggcatgaacctgctgcgc
gagccgcgcaacggccgcaacttcgagtatggcggcgaagatccgctgctggccggcgtg
atggtggccgagcaggtgcgcggcatcgagtcgaaccacgtgatttccacgatcaagcac
tatgcgctgaacgcccaggaaaccggccgcttcgaactggacgcccgcatcgacccggcg
gcgctgcgcatgtccgacctgttcgcgttccaggtcgcacttgaaatgacggatgccgga
tcgttcatgtgcgcctataaccggctcaacggtccgtatggctgcgagcatccgtggctg
ctgaacggcgtgctgaagggcgactggggctacaagggtttcgtgatgtccgactggggc
gccacgcacagcacggtggaggcagccaatgcgggcctggaccagcagtccggcttcgag
ttcgatcgctcgcattacttcggcggtgcgctggaagaagccgtggaaagcggcttcgtg
ccgcagaagcggctcgacgacatggtgctgcgcgtattgcgcacgatgttcgcgaagggg
gtggtcgaccatccggtgaaacaggacggcgcgatcgactacgaagcgcatggccgcatt
agccaggccgatgccgaggagggcatcgtgctgctgaaaaattcgggcaacttgctgccg
ctggcgaaggatgtgaggaagatcgtcgtcatcggcggccatgcggacaagggcgtgctg
gccggcggcggctcgtcgctggtgtacccgcgcggcggcaatgccgtgccgggcctgctg
ccggccacctggcccggccccatcatgtattacccgtcgtcgccgttgaaagcaatccag
gcccgcgtccctggcgcgcaggtggtgttcgatagcggtaccgatccggcaaaagccgcg
gccgccgcggcgggagccgacgtcgtgctggtgttcgccacccaatgggtcggcgaagcg
ctggacgcgacgtcgctggcgctgcccgataaccaggacgcgctgatcgccgcggtcgcc
gcggccaacccgaagacggccgtggtgctggaaaacagcggccctgtgctgatgccgtgg
gtggaccgggtcgccggcatcgtcgaggcgtggtatccgggcaccaatggcggcgaagcc
atcgcccgggtgctgttcggcgaggtcaatccgtccgggcgcctgccggccacgttcccc
gcttccgagcagcagttgccgcggccgaagctggacggcgacccggccaagcccgacgag
cgcttcacggtggactaccacgaaggcgccgccgtcggctacaagtggttcgacctgaag
ggccacaagccgctgttcccgttcggccacggcctgtcgtacacgcagttcggctacaag
gacctgaaggcgcagctggtcgacggcaaggtgcaggtgcgcttcaccgtcaccaacacc
ggcagcgtggcgggcaaggacgtgccgcaggtgtacgtgtcgccgctgtccgccaggtgg
gaggcacccaagcgcctggccggctgggacaaggtcgagctggcgccaggcgcgagcacg
aacgtgacgctggccatcgatccgcgcctgttcggcatggtgaagggcagcgcgaacacg
tggcacgtggccggcggccgctaccaggtaaagctggcgcgccatgcgctcgatgacgcc
gcacaaaccgtaacgattcaactgcctgcgcaggtgctggacgtggcaggccgtcccatg
acgaagaaaacgaaaggatga

DBGET integrated database retrieval system