KEGG   Massilia umbonata: FCL38_16095Help
Entry
FCL38_16095       CDS       T06138                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
mum  Massilia umbonata
Pathway
mum00053  Ascorbate and aldarate metabolism
mum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    FCL38_16095
Enzymes [BR:mum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     FCL38_16095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind NAD_binding_10 NAD_binding_4 Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: QCP11772
UniProt: A0A4P8HSW4
Position
3891757..3892572
Genome map
AA seq 271 aa AA seqDB search
MTTKKPFKRLLLTGAAGGLGKVLRERIKPWADVVRLSDIGDMGEAGEGEEIFQADLADKQ
AVLKMVEGVDAILHFGGISTENTFENIMFANIQGTYNIYEAAHRHGVKRIVFASSNHAIG
FYPQTQVIDADDPPRPDSMYGISKVFGEQLSRYYFDRTGIETVCLRIGSSFPSVNNPRMM
CTWLSYDDLLEALRVSLLTPRVGHTILFGASNNKRQWWDNRKAAHLGFQPKDSSEQFRAD
VPESGEYPPADDATFNYHGGKFIFDGPMYKD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaaaaacctttcaagcgcctgttgctgaccggcgcggccggcggcctgggt
aaagtgctgcgcgagcggatcaagccatgggcggatgtggtccgcctgtccgatatcggg
gacatgggcgaagccggcgaaggcgaagagattttccaggccgacctggccgacaagcag
gccgttttgaaaatggtggaaggcgtcgacgccatcctgcatttcggcggcatctcgacc
gagaacacgttcgagaacatcatgttcgccaacatccagggcacgtacaacatctacgaa
gcggcccaccgccacggcgtgaagcgcatcgtgttcgcatcgtcgaaccacgcgatcggc
ttctacccgcagacgcaggtgatcgatgcggacgacccgccgcgcccggacagcatgtac
ggcatctcgaaggtgttcggcgaacagctgtcgcgctactacttcgaccgcaccggcatc
gagaccgtgtgcctgcgcatcggttcgtcgttcccgtcggtgaacaacccgcgcatgatg
tgcacctggctgtcctatgacgacctgctggaagcgctgcgcgtctcgctgctgaccccg
cgcgtgggccacacgatcctgttcggcgcctcgaacaacaagcgccagtggtgggacaac
cgcaaggccgcccacctgggcttccagccgaaggactcctcggaacagttccgcgccgac
gtgccggaaagcggcgaatatccgccagccgacgacgccacgttcaactaccacggcggc
aagttcatcttcgacgggccgatgtacaaggactga

DBGET integrated database retrieval system