KEGG   Massilia umbonata: FCL38_29060Help
Entry
FCL38_29060       CDS       T06138                                 

Gene name
ribB
Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mum  Massilia umbonata
Pathway
mum00740  Riboflavin metabolism
mum00790  Folate biosynthesis
mum01100  Metabolic pathways
mum01110  Biosynthesis of secondary metabolites
Module
mum_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:mum00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FCL38_29060 (ribB)
   00790 Folate biosynthesis
    FCL38_29060 (ribB)
Enzymes [BR:mum01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     FCL38_29060 (ribB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     FCL38_29060 (ribB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: QCP14013
UniProt: A0A4P8HVL5
Position
6907667..6908776
Genome map
AA seq 369 aa AA seqDB search
MTISSTEEIVAELRAGRMVILVDEEDRENEGDLVLAADFVTPEAINFMIRYARGLVCLTL
AEEIVDRLELPLMATRNGTSFGTNFTVSIEAAEGVTTGISAADRARTIQVAVAKGAQPSD
LVQPGHIFPLRAVKGGVLMRAGHTEAGCDLTAMAGLTPASVICEIVKDDGTMARLPDLLE
FGKEHGLKIGTIADLIHYRSAKECMVERVAERELRTSHGDFRMIAFRDTPSGCAHLALVH
GDVAADDEALVRVHQPVSILDLLETEATTHSWNVSASLKAIKGAKSGVMVLLNCGETAEQ
LFGQLAALNKDAKPQGRAASMDLRTYGIGAQILRAIGVRRMKLLASPRKMPSMTGFDLEV
TGYLAKPEA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactatctccagcactgaagaaatcgtcgccgagctgcgcgccgggcgcatggtgatc
ctggtcgatgaagaggaccgcgaaaacgagggcgacctggtgctggcggccgatttcgtc
acgccggaagccatcaacttcatgatccgttatgcccgcgggctggtttgcctgacgctg
gccgaagaaatcgtcgatcgcctcgagctgccgctgatggcgacccgtaacggcacttcg
ttcggcaccaacttcaccgtgtcgatcgaggccgccgaaggcgtgaccacgggtatctcg
gcggccgaccgcgcccgcacgatccaggtagccgtcgccaagggcgcacagccgtccgac
ctggtgcagccgggtcatatcttcccgctgcgcgccgtcaagggtggcgtgctgatgcgc
gctggacacaccgaagcaggctgcgacctgaccgcgatggcgggcctgacgccggcttcc
gtgatctgcgagatcgtcaaggacgacggcacgatggcgcgcctgccggacctgctggag
ttcggcaaggagcacggcctcaagatcggcacgattgccgacctgatccactaccgcagc
gccaaggaatgcatggtcgaacgcgttgccgagcgcgagctgcgcacgtcgcacggcgac
ttccgcatgatcgccttccgcgacacgccgagcggctgcgcccacctggcgctggtgcat
ggcgacgtggcggccgacgacgaagcgctggtgcgcgtgcaccagccggtgtcgatcctg
gacctgctggaaacggaagcgaccacccactcgtggaacgtgtcggcttcgctgaaggcc
atcaagggggcgaaatcgggcgtgatggtgctgctgaactgcggcgagacggccgagcag
ctgttcggccagctggccgcgctgaacaaggatgccaagccgcagggccgtgccgccagc
atggatctgcgcacctacggcattggtgcccagatcctgcgcgcgatcggcgtgcgccgc
atgaaactgctggcgagcccgcgcaagatgccgtcgatgacgggcttcgacctcgaagtg
accggctacctggccaaacccgaagcttga

DBGET integrated database retrieval system