KEGG   Meriones unguiculatus (Mongolian gerbil): 110539626
Entry
110539626         CDS       T05884                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110539626
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110539626
Peptidases and inhibitors [BR:mun01002]
 Metallo peptidases
  Family M1
   110539626
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N KRAB
Other DBs
NCBI-GeneID: 110539626
NCBI-ProteinID: XP_021482141
Position
Unknown
AA seq 1000 aa
MTASPVNVPQDLLTFRNVTVDQSQEEWDCLDSVHRVVYVDAILENYSNLVFVGNLSKKMV
PLSLKCPLASMPSLLSLVLTFLTVLAPSWCQSSDTVSPKASNGAPFPWNNMRLPEYITPI
HYDLMIHANLSTLTFLGTAEVEITASQPASTIIMHSHQLQISKATLRKGVGETLSEEPLK
VLEYPAHEQIALLTPQPLLAGSLYTVIINYAANLSESFHGFYKSTYRTQEGEMRILASTQ
FEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVNVAEGLIEDHFDTTVK
MSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVSDKINQADYALDAAVTLLEFYEDYFNIPY
PLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFG
NLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEEYFFGKCFNAMEVDALNSSHPVST
PVENPAQIQEMFDDVSYEKGACILNMLRDYLSADTFKRGIVHYLQKYSYKNTKNEDLWNS
MVHICPTDGTQTMDGFCSRSQHSSSTSHWHQEVVDVKAMMNTWTLQKGFPLITITVRGRN
VHMKQEHYLKGSESTPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVEWIKFN
VGMNGYYIVHYEDGGWDSLSGLLKGAHTTISSNDRASLINNAFQLVSIGKLSIEKALDLT
LYLQNETEILPVFQGLNELIPMYKLMEKRDMNEMETQFKAFLLRLLKDLIDKQTWTDEGS
VSERMLRSQLLLLACVHKYQPCVQRAEGYFREWKASDGNMSLPADVTLAVFAVGAQKTEG
WDFLCSKYQSSLSSTEKSQIEFALCISQDPKKLQWLLDQSFKGDIIKTQEFPHILILIGR
NAVGYPLAWKFLRENWNNLVQKFELGSPAIAHMVTGTTEQFSTRERLEEVKEFFSSLKEN
GSQLRCVQQTIETIEENIRWMDKNLDKIRIWLQKKKQELL
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgactgcttctccagtaaatgtgccccaggatctgttgacattcaggaatgtgactgtg
gaccaatcccaggaggagtgggactgtctggattctgttcatagagttgtgtacgtggat
gcgatattggagaattacagcaacttagtttttgtaggtaatttgagcaagaagatggtg
cctctgtccctcaaatgcccacttgcaagcatgccctctctgctttccttagtattgact
tttttaactgtgttagctccttcttggtgtcagagcagcgatacagtatctccaaaagct
agtaatggtgccccattcccttggaataacatgcgacttcctgagtatatcactccgatt
cattatgatctcatgatccatgcaaacctcagcactctgactttcttgggaacagctgaa
gtagaaatcacagctagccagcctgccagcacaattattatgcatagtcaccagctgcaa
atatctaaggctactctcaggaaaggcgttggagagacgctgtctgaagagccgttgaag
gtcctggagtatcctgctcatgagcaaattgcactgctgactccccagccactacttgct
gggtccctgtacacagttatcatcaactatgctgccaacctgtctgagagcttccatgga
ttttataaaagcacctacagaacccaggaaggggaaatgagaatacttgcatcaacacag
tttgaacccacagctgctagaatggcctttccctgctttgatgagcctgcgttcaaggcc
agtttttccatcaagataaggagggagccaagacacctggccatctctaacatgcccttg
gtgaaatctgtgaatgttgctgaaggactcatagaagaccattttgacaccactgtgaag
atgagcacctacctggtggccttcattgtttctgattttaagtccgtgagcaagatgact
aagagtggagtgaaggtctctgtgtatgctgtgtcagacaagataaatcaagcagattat
gctctggatgctgccgtgactcttctagaattttatgaggattattttaacattccatat
cctttacccaagcaagatcttgctgcaattccagactttcagtctggtgctatggaaaac
tggggcctgaccacatatagagaatcctctctgctatatgataaagaaaagtcttctgca
tccagtaagcttggcataacaatgattgtgtcccatgaactcgctcaccagtggttcggg
aacctggtcaccatggaatggtggaatgacctttggctcaatgaaggatttgccaagttt
atggaatttgtgtctgtcactgtgacccatcctgaactaaaagttgaagagtatttcttt
ggcaagtgttttaatgcaatggaagttgatgcgctaaactcctcacaccctgtatccaca
cctgtggaaaatcctgcgcagattcaggagatgtttgatgatgtttcctatgaaaagggg
gcttgtattttgaacatgctaagagattatctgagtgcagatacatttaaaagaggaatt
gtgcactatctccaaaagtacagttataaaaacacgaaaaatgaggacctgtggaatagc
atggtacatatttgccccacagatggtacacaaacaatggatggcttttgctctagaagc
caacattcatcatctacttcacactggcatcaggaagttgtagatgtgaaagccatgatg
aacacatggaccctgcagaagggctttcctctgataaccatcactgtgagagggcggaat
gttcacatgaagcaagaacactacctgaagggttctgagagcaccccagagactgggtac
ctatggcacgttccactgacattcattaccagcaaatcagactcagtccagagattcttg
ctgaagacaaagacagatgtgcttatcctcccagaagcagtggagtggatcaaatttaat
gtgggaatgaatggctattacattgtgcattacgaggatggtggatgggattctcttagt
ggccttttaaaaggagcacacacaacaataagcagtaatgatcgggcaagtctcatcaac
aatgcatttcagctcgtcagcattggaaagttatcgattgaaaaagccctggatttaacc
ctgtacttgcaaaatgaaactgaaattttgcctgtattccaaggtttgaatgaactgata
cctatgtataagttaatggagaaaagagatatgaatgagatggaaactcaattcaaggcc
ttcctcctcaggctgctgaaggacctcattgataagcagacttggacagacgagggctct
gtgtcagagagaatgcttaggagccagctcctcctcctcgcgtgtgtgcacaagtatcag
ccctgtgtgcagagggcagagggctatttcagagagtggaaggcatctgatggaaacatg
agcctccctgctgatgtgaccttggcagtgtttgctgtgggggcccagaaaacagaaggc
tgggattttctttgtagtaaatatcagtcttctctgtcaagtactgagaaaagccaaatt
gaatttgccctttgcataagccaggacccaaaaaagcttcagtggctcctagaccaaagt
tttaagggagatataataaaaactcaggaatttccacatattcttatactcattggcaga
aatgcagtgggttatccattggcctggaagtttctgagggaaaattggaataatcttgta
caaaagtttgaacttggctcaccagccatagctcacatggtaacgggaacaacagaacag
ttttccaccagagaacgtcttgaagaggtaaaagaattcttcagctccttgaaagaaaat
ggttctcagctgcgttgcgttcaacaaaccattgagactattgaagaaaacattcgatgg
atggataagaatttggataaaatcagaatatggctgcaaaagaaaaagcaggaactgttg
tga

DBGET integrated database retrieval system