KEGG   Meriones unguiculatus (Mongolian gerbil): 110540094
Entry
110540094         CDS       T05884                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00230  Purine metabolism
mun00240  Pyrimidine metabolism
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110540094 (Dck)
   00240 Pyrimidine metabolism
    110540094 (Dck)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     110540094 (Dck)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18
Other DBs
NCBI-GeneID: 110540094
NCBI-ProteinID: XP_021482591
Position
Unknown
AA seq 309 aa
MATPPKRFCPSLSTSSEGTRIKKISIEGNIGKAPPPRCPCLRVRSPPPCPRRRGGSPGPA
PAGALLSTDYSCMQQMFSFLPHSKHCLFMKLVDLFALLYAKVLKVLPDPLLVCFCKSKEL
TTSQKSGGNVLQMMYEKPERWSFTFQAYACLSRIRAQLASLSGKLKDAEKPVLFFERSVY
SDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRATPEKCLNRIYL
RGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPVLTLDVNEDFKDKHESLVE
KVKEFLCTL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagaggttctgcccttccctctcgaccagctccgagggaacccgc
atcaagaagatctccatcgaggggaacatcggtaaggcgcccccgccccgctgcccgtgc
ctccgcgtccgctctccgcctccctgcccgcgccggcgcggtggctcgcctggcccggcg
ccagccggggctttgttgagtactgactactcatgtatgcagcagatgttttcatttcta
ccacattcaaagcactgtctctttatgaagcttgttgatctcttcgctctgctctatgca
aaagtccttaaagtccttcctgatcccctccttgtgtgcttctgcaagtcaaaggaattg
acaacgtctcagaaaagtggtgggaatgttcttcaaatgatgtatgagaaacctgagcgg
tggtcttttacatttcaagcatatgcctgtctcagtcggatccgagcccagcttgcctct
ctcagcggcaagctcaaagatgcagagaagcctgtgttgttttttgagcgatctgtgtat
agtgacaggtatatttttgcctctaatttgtatgaatctgactgcatgaatgaaacagag
tggacaatatatcaagactggcatgactggatgaatagccagtttggccaaagccttgaa
ctggacggaataatttatcttcgtgctactccagagaaatgcttaaacagaatatattta
cgaggaagaaatgaagaacaaggcattcctctcgaatatttagagaaacttcactataaa
catgaaagctggctccttcatcgaactctgaaaaccaacttcgattatctccaagaggtg
cccgtcctcacgctggatgttaatgaagactttaaagacaaacatgaaagtctggttgaa
aaggtcaaagaatttttgtgtactctgtga

DBGET integrated database retrieval system