KEGG   Meriones unguiculatus (Mongolian gerbil): 110543025Help
Entry
110543025         CDS       T05884                                 

Definition
(RefSeq) alkaline phosphatase, placental-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00730  Thiamine metabolism
mun00790  Folate biosynthesis
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    110543025
   00790 Folate biosynthesis
    110543025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110543025
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mun00537]
    110543025
Enzymes [BR:mun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     110543025
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110543025
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mun00537]
 Enzymes
  110543025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 110543025
NCBI-ProteinID: XP_021485152
Position
Unknown
AA seq 537 aa AA seqDB search
MWGACLLLLGLRLQLSLSVVIPVEEENPAFWNQKAAEALDAAKKLQPIQTSAKNLIIFLG
DGMGVSTVTATRILKGQMDGHLGPETPLAMDRLPHMALSKTYNTDMQIPDSSATATAMLS
GVKTNFKVIGLSAAARFNECNSTWGNEVISVMQRAKKAGKSVGVVTTTSVQHASPAATYA
HTVNRNWYSDAEMPASALQEGCKDISTQLISNMDIDVSSNSEGVILGGGRKFMFPKGTPD
QEYPANPGQGGTRLDGRNLVQEWLAKHQGAQYVWNRSQLIRMSLDPSVTHLMGLFEPDFM
TYDIYRNPTEDPSLVEMTEVAIRMLSRNPRGFYLFVEGGRIDHGHHESVAYRALTEAVVF
DSAIDKADRLTSEQDTMILVTADHSHVFTYGGYTHRGSSVFGLAPFKAQDGKSFTSILYG
NGPGYRLHDGVRADVTEEESSHPLYRQQAAVPLDSETHGGEDVAIFARGPQAHLVHGVQE
QNYIAHVMAFAGCLEPYTDCGLAPPAGHSIAATQTSTLLLLMAGMVFTLVAAAELTI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtggggagcgtgcttgctgctgctgggcctcaggctacagctatccctcagcgtcgtc
atcccagtggaggaggagaacccggccttctggaaccaaaaggcagccgaggccctggat
gctgccaagaagctgcagcccattcagacatccgccaagaacctcatcatcttcctgggg
gatgggatgggagtgtccacagtgacagctacccggatcctaaagggacaaatggacggt
catctaggacctgagacacccctggccatggaccgcctcccacatatggctctgtccaag
acatacaacacagacatgcagatcccagacagctcggccacagccacagccatgctctcc
ggggtcaaaaccaacttcaaggtcattggcttgagcgcagctgcgcgctttaacgagtgc
aactcaacgtggggcaatgaggtcatctcggtgatgcagcgcgccaagaaagcaggaaag
tctgtgggggtggtgaccaccacgtcggtgcagcacgcctccccagccgccacctacgca
cacacggtgaaccgtaattggtactcggatgcggaaatgcctgcctcggcgttgcaggag
ggctgcaaggacatctctacacagctcatctccaacatggatattgatgtgagctccaac
agtgagggggtgatccttggtggtggccgcaagttcatgtttcccaaggggacgccggac
caggaatatccagctaaccctggccagggtggaaccaggctagatggccgcaacctagtt
caagagtggctggcaaagcaccagggagcccagtatgtctggaaccgctcgcagctcatt
cggatgtccctggatccttctgtgacacatctcatgggcctctttgagcctgacttcatg
acatacgacatctaccgaaaccctaccgaagacccttccctggtggagatgacagaggtg
gccatccgcatgctgagcaggaacccccgaggcttctatctctttgtggaagggggccgc
atcgaccatggccaccatgaatctgtagcctaccgcgcactgaccgaggctgtcgtgttt
gactctgccatcgacaaggcggacaggctcaccagtgagcaggacacaatgatcctcgtc
accgctgaccattcccacgtcttcacttatggtggctacacacacagggggagctccgtc
tttgggctggctcccttcaaggctcaggacggcaaatcctttacctcaatcctatatggc
aatggtcccggctacaggctccacgacggcgtccgggctgacgttaccgaagaagagagc
agccaccccttgtaccggcagcaggcggctgtgcccttggacagcgagacccacggcggg
gaggacgtggccatcttcgcgcgcggcccgcaggcgcacctggtgcacggggtgcaggag
cagaactacatcgcgcacgtcatggccttcgcgggctgcctggagccctacaccgactgc
ggcctggcgccccctgccggccacagcattgcggcgacccagacctccaccctgctgctc
ctgatggcagggatggtgttcacactggtggcggcagctgaactgactatctag

DBGET integrated database retrieval system