KEGG   Meriones unguiculatus (Mongolian gerbil): 110543418Help
Entry
110543418         CDS       T05884                                 

Gene name
Hsd17b8
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00061  Fatty acid biosynthesis
mun00140  Steroid hormone biosynthesis
mun01100  Metabolic pathways
mun01212  Fatty acid metabolism
Module
mun_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110543418 (Hsd17b8)
   00140 Steroid hormone biosynthesis
    110543418 (Hsd17b8)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     110543418 (Hsd17b8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     110543418 (Hsd17b8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR RmlD_sub_bind RNA_pol_Rpb1_4 Epimerase
Motif
Other DBs
NCBI-GeneID: 110543418
NCBI-ProteinID: XP_021485436
Position
Unknown
AA seq 259 aa AA seqDB search
MASQLRLCSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDEAAAQDTVRLLSGPGSED
GAPRGKHAAFQADVSQAPAAGRLLQQVQACFARPPSVVVSCAGITRDEFLLHMSEDDWDR
VIAVNLKGTFLVTQAAAQALVSSGCRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQT
AARELGRHGIRCNSVLPGFIATPMTRKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLAS
EDSGYITGASVEVTGGLFM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcaactccggctttgctccgcgctggccttggtcacaggtgcgggtagcggc
atcggccgggccatcagcgtgcgcctggcggcagagggcgccgccgtggccgcctgcgac
ctggacgaggcagcggcccaggacaccgtgcggctgctgagcggcccggggagcgaggac
ggggcgccgcgcgggaagcacgccgccttccaggcggacgtgtcgcaggcccccgcagcc
gggcgcctgctgcagcaagtgcaggcctgcttcgctcgcccgccatctgtcgtcgtgtcc
tgtgcgggcatcacacgcgatgagtttctgctccacatgtcagaagacgactgggacaga
gtcatcgccgtcaacctcaagggcactttcctagtcactcaggctgcagcccaggctttg
gtgtccagcggctgtcgcggctccatcatcaacatcagtagcatcattggaaaggtgggg
aatattggacaaacaaattatgcgtcctccaaagcaggagtgattgggctcacccagact
gcagcccgggagcttggacgacacggcatccgatgtaactcggtcctcccggggttcatt
gcaacacccatgacccggaagatgccagagaaagtgaaggacaaggtaactgcaatgatc
ccgctggggcacatgggggaccctgaggatgtggcagatgtggttgcgttcttggcgtcc
gaagacagtggctacatcacaggggcctccgtggaagtcaccggaggtcttttcatgtaa

DBGET integrated database retrieval system