KEGG   Meriones unguiculatus (Mongolian gerbil): 110545375
Entry
110545375         CDS       T05884                                 

Gene name
Ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110545375 (Ahrr)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110545375 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 110545375
NCBI-ProteinID: XP_021487111
Position
Unknown
AA seq 633 aa
MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIIA
KLDKLSVLRLSVSYLRVKSFFQALRETCVWPAPSLSPEDHPHRECPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDSAVLGKLLGAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKAPSGTALPPRLSLFCIVVPVLPSVAEMKMKSAFLRAKHRADIVVTMDSRD
KEEDQKHVLRRSPGARGQREMHKYSYGSETPVRLRHLNWSIEQRSQEDTTKLTRQPSKNE
SSTCLEPHGSCVPYSGSQGMFGASNVTSFRDSPDHPTGAYCSQMNRPLQEIHQRQMEPSP
CHVPQGSLGSRIPLPGTQHFTARGLSTEDTKLPSLPVTIGTPCNPVLSLEVPIKRESESG
SQDIADASTTSRVWLGTSDMARRHLVSFPARLHLKTEPDYRQQVCTPHLGHGMLGANPHS
KDTVGSCREQAPLYPTHCTCLDPELPPQLFMQGHSESQHSPLGQGCRAPIVKREPLESPA
WAVPGQVAVPRVFPKSASITVIPPKGSNGIFLP
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgatgattccatcgggagagtgtacgtacgctggaaggaagagaaggaaacccattcag
aagcggaggcttaccatgggggctgagaaatcaaatccttccaaacggcaccgggaccgc
ctcaatacagagctggaccacctggccagcctgctgccattttcacctgacatcatcgcc
aagttggacaagctttccgtcctgcgtctcagcgttagttacctcagggtgaagagcttc
ttccaagccttgagagagacatgtgtctggccagctccatccctgtcaccagaagaccat
ccacacagagagtgccctgtgcaggaaggacggctgctgctggagtctctcaatggcttt
gccctggtggtgagtgcagaagggatgatcttttatgcatcagcaacaattgtggactat
ctgggcttccatcagacggatgtaatgcaccaaaacatttatgactacatccatgtggat
gaccgacaggacttctgcagacagctccactgggccatggaccctccacaggtggtgttc
gggcagtccccacatgctgacacagacagtgccgtcctggggaagctgcttggggcccag
gaagggggcaagggattgccctccgagtactcggccttcttgacacgctgcttcatttgt
cgggttcgctgtctgctggacagcacctccggctttctgactatgcagttccaaggaaaa
ctaaaattcctatttggacagaagaagaaggcaccatcaggaaccgcactgcctccccgg
ctctcattgttctgcattgtggtgccagtcctgccttctgtggctgaaatgaaaatgaaa
agtgctttcttgagggcgaagcatagggcagacattgtggttacaatggattcaagggac
aaagaagaggaccagaagcatgtactaaggagatcccctggtgcccggggccagagggag
atgcacaagtacagttatggctcggagacaccagtacgcttgaggcacctgaactggagc
atagaacagcgaagtcaggaggacactaccaagctgactcgacagcccagtaagaatgag
tcctccacatgtctggagccccatggttcctgtgtgccctactctgggagccagggcatg
tttggggccagcaatgtgacttctttcagagattcaccagaccatcccactggtgcctac
tgcagccaaatgaacagacccttgcaggagatccaccagcgccagatggagccttcccct
tgtcatgtcccccagggcagcctgggatcgagaatccctctgcctggaacgcagcacttc
acagccaggggcctttcgacagaggatacaaaattgcccagcctgccagtgaccatcggc
accccatgtaatccagtattgtcactggaagtgccaatcaagagggaaagtgagtctgga
tcccaggatatagctgatgccagcacaactagccgggtgtggctgggaaccagtgacatg
gctaggagacatctggtcagtttccctgccaggttgcacctgaaaacagaacctgactat
aggcaacaggtctgtaccccacaccttgggcatggtatgctgggagctaatccccacagc
aaggatactgtcggatcctgcagggagcaggctcctctttatcctacacattgcacctgc
ctggatccagagcttcctcctcaactcttcatgcagggccacagtgagagccagcactct
cctttgggccaaggctgcagagctcctattgttaagcgtgagcccctggaatcaccagca
tgggccgtacctggtcaggtggctgtgcccagggtgttccctaagagtgcctctataact
gtgatccctcccaaaggctccaatggaattttcctaccctag

DBGET integrated database retrieval system