KEGG   Meriones unguiculatus (Mongolian gerbil): 110545910Help
Entry
110545910         CDS       T05884                                 

Gene name
Hmgcs2
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, mitochondrial
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00072  Synthesis and degradation of ketone bodies
mun00280  Valine, leucine and isoleucine degradation
mun00650  Butanoate metabolism
mun00900  Terpenoid backbone biosynthesis
mun01100  Metabolic pathways
mun03320  PPAR signaling pathway
Module
mun_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110545910 (Hmgcs2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    110545910 (Hmgcs2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110545910 (Hmgcs2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110545910 (Hmgcs2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110545910 (Hmgcs2)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     110545910 (Hmgcs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 110545910
NCBI-ProteinID: XP_021488026
Position
Unknown
AA seq 508 aa AA seqDB search
MQRLLAPARRVLQVKRVMQETSLPPAHLFSATHQRFSTIPPTPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLP
WDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSYWDGRYALVVCGDIAVYPNGNARPTGGAGAVAMLIGPKAPLILEQGLRGTHMENAYD
FYKPNLASEYPLVDGKLSIQCYMRALDRCYATYRKKIQNQWKQAGNNQPFTLDDVQYMIF
HTPFCKMVQKSLARLMFSDFLSSSSDKQNDLYKGLEAFRGLKLEETYTNKDVDKALLKAS
LDTFNKKTKASLYLSTNNGNMYTSSLYGCLASLLAHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPG
DTSNLFPGTWYLERVDEMHRRKYARRPI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcttttggctccagcaaggcgagtcctgcaggtgaagagagtgatgcaggaa
acttcgctcccgcctgctcacctgttctcagcaacccaccagaggttttctacaatccct
cctactcctctggccaaaacagatacttggccaaaagatgtgggcatcctggccctggag
gtctacttcccagcccaatatgtggaccaaactgacctggagaagtttaacaacgtagaa
gcagggaagtatacagtgggcttgggccagacccgtatgggcttttgttcggtccaggag
gacatcaactcactgtgcctgacagtggtgcagaggctgatggagcgcacaaagctgccg
tgggatgctgtgggccgcctggaagtgggcaccgagaccatcattgacaagtccaaggct
gtcaaaacagtgctcatggaactcttccaggattcaggcaacactgacattgaaggcata
gacaccaccaatgcctgctatggtggcactgcctccctcttcaatgctgccaactggatg
gagtccagctactgggatggtcgttacgccctggtggtctgtggggacattgcggtctac
ccaaatggtaatgcccggcccacaggtggtgccggggctgtggcaatgctgatcgggccc
aaggccccactaatcctggagcaaggcctgaggggaacccacatggagaatgcatacgac
ttctacaaaccaaacttggcctcagagtatccgctggtggacgggaagctctccatccag
tgctacatgcgggccttggatcgatgctacgcaacctaccgcaagaaaatccaaaaccag
tggaagcaagctggaaacaaccagcctttcaccctcgatgatgttcaatatatgatcttc
catacacccttctgcaagatggtccagaaatccctggctcggctgatgttcagtgacttc
ctgtcgtccagcagtgacaaacagaacgatttgtacaaggggctggaggcttttaggggt
ctaaagctggaagaaacctacaccaacaaggatgtagacaaggctcttttgaaggcctcc
ctggacacattcaacaagaaaaccaaggcttccctttacctctccacgaacaacgggaac
atgtacacgtcatccctctatgggtgcctggcttcactgctcgcccaccactctgcccag
gaactggctggctccaggattggtgccttttcctacggctcaggcttagcagccagtttc
ttttcgtttcgagtctccaaggatgcttctccaggttcccctctggagaagctggtgtct
agtgtgtcagatctgcccaaacgtctagactctcggaggcgcatgtcccctgaggaattc
acagaaataatgaaccaaagagagcaattctaccacaaggtgaacttctctccacctggc
gacacaagcaacctcttcccgggtacttggtaccttgaaagagtagatgagatgcatcgc
agaaagtacgcccggcgccccatctaa

DBGET integrated database retrieval system