KEGG   Meriones unguiculatus (Mongolian gerbil): 110546199Help
Entry
110546199         CDS       T05884                                 

Gene name
Nmnat2
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00760  Nicotinate and nicotinamide metabolism
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    110546199 (Nmnat2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     110546199 (Nmnat2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     110546199 (Nmnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 110546199
NCBI-ProteinID: XP_021488556
Position
Unknown
AA seq 312 aa AA seqDB search
MFTPGASALPQSVRRLLEAGGPGFDLQHSLKKTERARDYLHKTGRFIVIGGIVSPVHDSY
GKQGLVSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILS
NVNTPSMTPVIGQPQHENTQPIYQNSNVTTKPTAAKILGKVGESLGRICCVRPPVERFTF
VDENANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAA
DTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDY
ILKSQLYINASG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgcctggggcctcagcattgcctcagtccgtgaggcgtttacttgaggctgga
ggacccggcttcgatctccagcattcacttaaaaagacagaaagagccagggattatctg
cacaagactggaaggtttatcgtgattggtggcattgtctctccggtccacgactcctat
ggcaaacagggccttgtgtcgagtcggcaccgtctcatcatgtgtcagctggctgtccag
aattccgactggatcagggtggacccatgggaatgctaccaggacacttggcagacgacc
tgcagtgtgctggagcaccatcgagacctcatgaagagggttactggctgcatcctctcc
aatgtcaacacgccatccatgacacctgtgattggtcagccacagcatgagaacacccag
cccatctaccagaacagcaatgtgaccaccaagcccactgcagccaagatcttagggaag
gtgggagaaagcctcggccggatctgctgtgtacgcccacccgtggagcgcttcaccttt
gtagatgagaatgccaacctgggcacagtgatgcggtatgaggagatcgagctgcgcatc
ttgctgctgtgtggcagtgacctgctggagtccttctgcatcccgggactctggaacgag
gcagatatggaggtgattgtcggggattttgggatcgtggtggtgccccgggatgcagcc
gacacagaccgaatcatgaatcactcctcaatactccgcaaatataaaaacaacatcatg
gtggtaaaggatgacatcaaccaccccatgtctgtagtcagctccaccaagagcaggctg
gccctgcagcacggggacggccatgtcgtggactacctgtcgcagccagtcatcgactac
atcctcaagagtcagctgtacatcaacgcctccggctag

DBGET integrated database retrieval system