KEGG   Meriones unguiculatus (Mongolian gerbil): 110546839Help
Entry
110546839         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, brain isoform-like
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00071  Fatty acid degradation
mun01212  Fatty acid metabolism
mun03320  PPAR signaling pathway
mun04152  AMPK signaling pathway
mun04714  Thermogenesis
mun04920  Adipocytokine signaling pathway
mun04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110546839
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110546839
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110546839
   04920 Adipocytokine signaling pathway
    110546839
   03320 PPAR signaling pathway
    110546839
  09159 Environmental adaptation
   04714 Thermogenesis
    110546839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mun03029]
    110546839
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110546839
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110546839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 110546839
NCBI-ProteinID: XP_021489667
Position
Unknown
AA seq 802 aa AA seqDB search
MAEAHQASSLLCSLSSDGAEVELSSPVWQEIYLSGLRSWKRHLWRVWNDIFTGVVPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPAWAGQYHQLQELLAAALFASCLWGALIF
TLHVALRLLLSHHGWLLEPHGIMSSPTKTWLALVRIFSGRNPRLFGFQRALPRQPVPTAQ
ESVRKYLESVRPVLGDEAFDRVAALASDFLRLQAPRLQRYLHLKSWCASNYVSDWWEEFV
YLRSRGSLMVNSTYYLMDFLYVTPTPLQAARAGNAAHALLLYRHLLNQQEIAPTLLMGMR
PLCSAQYERIFNTTRVPGVEKDYLRHLRDSRHVAVFHRGRFFSVGTHSSSGLLSPRALEQ
QFQEILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAAAALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIAFSNGKLGLSVEHSWADCPVPGH
MWEFTLATECFQLGYAADGHCKGTPDPTLPRPERLQWELPEQIHPSISLALRGAKTLSGN
VDCHVFPFSHFGKSFIKRCHVSSDSFIQLVLQLAYFRDRGQFCLTYESAMTRLFLEGRTE
AVRSCTTEACRFVRAMEDKEKTDQQCLALFRVAVDKHQALLKAAMSGQGIDRHLFALYVM
SRFLHMQSPFLTQVQSQQWPLSTSQIPVQQTHLFDFHNYPDYVSSGGGFGPASDQGYGIS
YIFMGENMITFHISSKKSSIKTDSHRLGQRIESALLDVASLFQAGXHFKCQFRSLGENSG
HRRGVLSNETADPKGPTTSTNF
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcacaccaggcctccagcttgctgtgttcactgagctccgacggggcagaa
gtggagctcagctcccctgtgtggcaggagatttacctctccggcctgcgctcctggaaa
aggcatctctggcgtgtctggaacgacatttttactggcgtggtccctgcaagccccctc
agctggctcttcctcttcagtgcaatccagctggcttggttcctccagctggatccttcc
ctaggactgatggagaagattaaagagttgctgccagcctgggctggacagtaccatcag
ctccaggagctcctggcagcagcactgtttgcctcatgtttgtggggagctctgatcttc
acacttcatgtggctctgaggctccttctgtcccaccatggctggcttctggaacctcat
ggcatcatgtcctcacccacaaagacctggctagcactggtccgaatcttctctggaagg
aacccgaggctgtttggcttccaacgcgcgctcccgcgacagcctgtgcccacggcgcag
gagtccgtacgcaagtacctagagtcagtgcgccctgtgcttggggacgaagctttcgac
cgcgtggcggcgctggcgagcgacttcctgaggttgcaggcaccgcggctgcaacgctac
ctgcacctcaagtcctggtgtgcttccaactacgtcagtgactggtgggaagagtttgtc
tacctgcgctcccgaggctcactgatggttaacagcacctactacctgatggattttctg
tatgtcacacccacgccactgcaggcggcacgcgcgggcaacgccgcccatgccctcctc
ctgtatcgccacctcctgaaccagcaggagatcgcaccgactttgctgatggggatgcga
cccctgtgctctgcccagtacgagaggatattcaacaccacgagggttccaggggtggaa
aaagactacctccgtcacctccgggatagccggcatgtggctgtcttccatcggggccga
ttcttcagcgtagggacccactcttccagtggcctgctgtctccacgggccctagagcaa
cagttccaggaaatcctagatgacccctccccagcctgcccccttgaggaacacttagct
gctctgactgctgcgcccaggagtatgtgggcccaggtgcgggagtcagtgaagacccat
gctgctgccgccctggaggctgtggaaggggctgccttctttgtgtcccttgattctgag
ccggcaggactgaccagggaggaccctgcagcttccctggatgcctatgcccacgctctg
ctggctggccgaggccatgaccgctggtttgacaaatccttcaccctcatcgccttctcc
aatgggaagctgggcctcagcgtggagcactcgtgggctgactgccctgtccccggacat
atgtgggagtttaccttggccacagagtgcttccagctgggctacgctgcagatggccac
tgtaaagggacccctgaccccaccctgccgcggcctgagcgcctgcagtgggagctgccg
gagcagattcacccgtccatctccctggccctgaggggagccaagaccttgtcgggcaat
gtcgactgccatgtcttccccttttcccatttcggcaagagcttcatcaaacgttgccat
gtctcttcagacagcttcatccaattggtcctgcagctggcctacttccgggacaggggt
caattctgcttgacttatgagtcagccatgacccgactgttcctggaaggcaggacagag
gcggtgaggtcttgcactacagaggcctgtcgctttgtgagagccatggaggacaaggag
aagacagaccaacagtgccttgccctgttccgggtggctgtggacaagcaccaggctcta
ctgaaggcagcaatgagcgggcaggggattgaccggcacctgtttgcactctatgtcatg
tcgcgattcctccatatgcagtcgcccttcctgacccaggtccagtcacagcagtggccg
ctgtccaccagccagatccctgtgcagcagacgcacctgtttgatttccacaattatcca
gattatgtttcctctggcggtggatttgggcctgccagcgaccaggggtatggcatctcc
tatatcttcatgggggaaaacatgatcaccttccacatctccagcaagaaatcaagcata
aaaacagactcgcatcggctggggcagcgcattgagagcgccctgttggatgttgcctcc
ctgttccaggctggcnagcatttcaagtgccagttcaggagtcttggggagaactcggga
cacagacgtggtgttctctccaacgagactgcggaccccaagggccccacaacctccacc
aacttttga

DBGET integrated database retrieval system