KEGG   Meriones unguiculatus (Mongolian gerbil): 110547774
Entry
110547774         CDS       T05884                                 

Gene name
Akap5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110547774 (Akap5)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110547774 (Akap5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 110547774
NCBI-ProteinID: XP_021491240
Position
Unknown
AA seq 686 aa
MKECSVKTEETVVSEIQVETKDEKGPVAVSPQEERQERKTATLCFKRRKKANKMKPKADS
KTVEVTKKHLPEAGDSGQSQPAGAWASIKRLVTHRKRSESSKKLKLSEPEEPEDLALPKK
KAKSRLKIPCIRFSRGAKRSRHSKLTEDSGYVRVQGEADDLETKAQTQLADQATQAKSTQ
EGVLAEAGKEVRESHVSNSVTSGENVISVQLELENESSAIQMGTPGLETETKVIKETQHV
QAQRASSEAGSPRPVASAAPPSPATAHPHRCSVGEPSEDTQESTPSGKDERSRKSAAAEK
KSGGIVLSQAEETAVSQAEETAVSQAEETAVSQVREVTVSQAEKTSVGQASQAEAATVAQ
AEAATVAQAEAATVAQAEAATVAQAEAATXXXXAEPATVAQAEAATVAQAEEATVAQAKQ
ATVAQAEEATVQTEEATVGQEEEDIMAQAEAATVSQAEEDTGAQAEEDTVQAEEATVGRA
EEDTGAQTEDDTVQAEEATVGRAEEDTGAQTEEATVGRAEEDTGAQTEDDTVQAEEATVG
RAEEDTGAQTEEDTVQAEEDTGVQAEEAAISRAPDLKENGLDTEKPRSEESKRMEPIAII
ITDTEISEFDVKKSKNVPKQFLISMESEQVGVFANDSDFEGRTSEQYETLLIETASSLVK
NAIELSVEQLVNEMVSEDDKINTLLQ
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaaggagtgcagtgtcaaaacggaggagaccgtggtttctgagattcaagtagaaact
aaggatgagaaggggccggtagcagttagtcctcaggaggagaggcaagagagaaaaaca
gctacactctgcttcaagagaaggaagaaagcaaacaagatgaagcccaaggctgattcc
aagactgttgaggtgacaaagaagcatctcccagaagccggggattctggtcagtcgcag
ccagcgggggcctgggcctccatcaaacgccttgtgacacacaggaaaaggtccgagtct
tcaaagaagctgaagctatctgagcctgaagagcctgaggacttggcccttcctaagaaa
aaagcaaaatccagacttaagattccttgcataagattctcaagaggggcaaagcgaagt
cgccattccaaactcacggaagactcaggctacgtcagagtccagggagaggctgatgat
ttggagacaaaagcccagacccagctggctgaccaggcaacccaggctaagtccacccag
gaaggtgtgttggcagaagctggtaaggaggtccgagaatcgcatgtaagcaacagcgtc
acgtcgggggagaatgtgatttccgtacaactggaattagaaaatgagtcttctgctatt
cagatgggcaccccggggcttgaaacagaaactaaagtgattaaggaaacgcagcatgta
caggcgcagcgagcaagttcagaagcaggcagcccgcgaccagtggcttctgctgctcct
ccctcaccagcaaccgcacatccacatcggtgcagtgtgggagagcccagtgaggacacc
caagaaagcacaccaagtgggaaagatgagaggagcagaaagagtgctgctgcagaaaag
aaatcaggaggaattgtgctgagccaggcagaggaaactgccgtgagccaggcagaggaa
actgccgtcagccaagcagaggaaactgccgtcagccaagtaagggaagttacagtcagc
caggcggagaaaacttcagtgggccaagccagccaggcagaggcagccacagtagcacag
gcagaggcagccacagtagcacaggcagaggcagctacagtagcacaggcagaggcagct
acagtagcacaggcagaggcagctacnnnnnnnnnnnaggcagagccagctacagtagca
caggcagaggcagctacagtagcacaggcagaggaagctacagtagcacaggcaaagcaa
gctacagtagcacaggcagaggaagctacagtgcagacagaggaagctacagttggccag
gaggaggaagacataatggcccaggcagaggcagctacagtcagccaggcagaggaagac
acaggggcccaggcagaggaagacacagtgcaggcagaggaagctacagttggccgggca
gaggaagacacaggggcccagacagaggatgacacagtgcaggcagaggaagctacagtt
ggccgggcagaggaagacacaggggcccagacagaggaagctacagttggccgggcagag
gaagacacaggggcccagacagaggatgacacagtgcaggcagaggaagctacagttggc
cgggcagaggaagacacaggggcccagacagaggaagacacagtgcaggcagaggaagac
acaggggtccaggcagaggaagctgcaataagccgggcaccagatctgaaagaaaatgga
cttgatacagagaaacccagatcagaagaaagcaaaagaatggagccaattgctattatc
attacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaagcaa
ttcctaatttcaatggaaagtgagcaagtaggggtttttgctaatgacagtgatttcgag
gggagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctctcgtcaag
aatgccatcgagctgtctgtagagcagctggttaatgaaatggtctctgaggatgataag
ataaatactctgctacaatga

DBGET integrated database retrieval system