KEGG   Meriones unguiculatus (Mongolian gerbil): 110549223Help
Entry
110549223         CDS       T05884                                 

Gene name
Wnk2
Definition
(RefSeq) serine/threonine-protein kinase WNK2 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110549223 (Wnk2)
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110549223 (Wnk2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110549223 (Wnk2)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: Other
  Wnk family
   110549223 (Wnk2)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110549223 (Wnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 110549223
NCBI-ProteinID: XP_021493846
Position
Unknown
AA seq 2213 aa AA seqDB search
MDGDGGRRDAPGALMEAGRGTGSAGMAEPRARAARLGPQRFLRRSVVESDQEEPPGLEAT
ETPSAQPPQPLQRRVLLLCKTRRLIAERARGRPAAPAPAAPAAPPASPSGPSDPGPERAG
TQEPSPDPATASAAAAPVPDGGPQQEEAPAPTQEDAGATEAKPEPGRARKDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFK
EEAEMLKGLQHPNIVRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRS
WCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEK
VHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRLWV
EDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIDSGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQSQEPKDSGSPDKARGPPAPLQVQVTYHAQGGQPGQPEPEEPEADQHLLP
PTLPASVTSLASDSTFDSGQGSTVYSDSQSSQQSMVLSSLVDTAPTPASCVCSPPVSEGP
GLTHSLPALGAFQQPAAVPGLSVGPVPSPARPPLLQQHFPEPSMSFAPVLPPPSTPVPTG
PSQPAPPVQQPLPMAQPPTLPQVLAPQPMGTVQPVPSHLPPYLAPASQVVAPAQLKPLQM
PQPLAQVPPQMPPMPVVPPITPLTGLDGLPQTLTDLPAANVAPVPPPQYFSPAVILPSLT
TPLPTSPALPLQAVKLPHPPGAPLAMPCQTIVPNAPAAIPLLAVAPQGVAALSIHPAVAQ
IPAQIPAQPVYPAAFPQMAPADIPPSPHHTVQSLRATPPQLASPVPPQPVQPSVVHLPEQ
AAPTAASGTQVLLGHPPSYTADVAAPVSAVSLPPAVLSPPLPDTLLPAAPELLPKLPSSL
APAVVAASQSVPAQTSTLLPPANPPLSAGPAAAGPCPAVQLTVEAAPEEQVSQDKPAGPP
QSCESFGGSDVTSGRDLSDSCEGSFGGGRLEGRAARKHHRRSTRARSRQERASRPRLTIL
NVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPDEIATYMVEHDFILPAERETFIEQMKD
VMDKAEDMLSEDTDVDHGSDTGTSPPHLGTCGLATGEENGQSQANAPVYQQNVLHTGKRW
FIICPVAEHPAADTSESSPPLPLSSLQPEASQEPAPFPDQPSLKDRPSFPAAQQLLSQAG
SSNPPGGASTPLAPSSPPVTTVIPAAPATSTVPESAAGTAKQAGGPGTHQGPASVHETLQ
PLVETHHAQRAAQPLSTGQGPCTPAPEASQCSTGLGEAISTREVSTAGEPLPAGVPEPSP
PTGATQPVSGQPPPPLPITVGTISLAAPQLPSPPLGPAAPPPPPSALESDGEGPPPRVGF
VDNTIKSLDEKLRTLLYQEHVPTSSASAGTPMEASDREFTLEPLRGDPPAALSDRTPGLT
QQAHPSLEKSETAPAGWALTQREQGASSPMTAESSSSNTLGCDSDTGQVASDSPTAPSVP
QDAPVSSAPMHMDPKDQSTSVPREALAAPVQSCPGTFTEGSPAQMRGARVSGSPHKRPGQ
QDSSSPAKMVGRFSVVSTQDEWTLASPHSLRYSAPPDVYLDEIPSSPDVKLAVRRVQTAS
SIEVGVEEPASSDSGDECPRRRPQVQKQASLPGSGSVASDFVKKATAFLHRSSRAGSLGP
ETPSRAGVKVPTISITSFHSQSSYISSDNDSEFEDADIKKELRSLREKHLKEISELQSQQ
KQEIEALYRRLGKPLPPNVGFFHTAPPMGRRRKTSKSKLKAGKLLNPLVQQLKVVASSTG
HLSDSSRGPPTKDPAHASTPPGTKAVQTQQPCSVRASLSTDICSGLANDGGGAHGQGWTV
NHPTSERGAYKSSSKPRARFLSGPVSVSIWSALKRLCLGKEHSSRSSTSSLAPGPEPGPQ
PTLHVQAQVNNSNNKKGTFTDDLHKLVDEWTAKTVGTAQLKPTLNQLKQTQKLQDMEASG
EARATTVPRAGAGTPCLAPAPGPLSATAIPGAIPALPVPTPGTAHSSASGPPCALPLSQY
EGLLPVPVSWGPWVASGNPQGSGGSQSPTRVPMLPVFLRPPVISTPGPRLHIT
NT seq 6642 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgatggcggccgccgagacgcccccggcgcgctgatggaggccgggcgcggc
acggggtcggcgggcatggcggagccgcgggcgagggcggcgcggctcgggccccagcgc
tttctgcggcgcagcgtggtggagtcggaccaggaggagccgccgggcctggaggcgacc
gagacgccgagcgcgcagcccccacagcccctgcagcgccgggtgcttctgctctgcaag
acgcgccgcctcatcgcggagcgcgcccggggccgccccgccgcgcccgcgcccgccgcg
cccgcagcgcctcccgcctccccgagtggcccctcggaccctggcccagagcgagccggc
acgcaggagcccagcccagatcccgccaccgcctcggccgcagccgcgccggtccccgac
ggcggtccgcagcaggaggaggcgccggccccgacgcaggaggacgctggagccaccgag
gcgaagccggagcccgggcgcgcacgcaaggatgaacctgaggaggaggaggacgatgag
gacgacctcaaggccgtggccacctccctggacggccgcttcctcaagttcgacatcgag
ctgggccggggctccttcaagacggtctacaagggactggataccgagacctgggtggag
gtggcgtggtgtgaactgcaggaccggaagctcaccaagcttgaacggcagcggttcaaa
gaggaagcggagatgctgaaaggcctacagcaccccaacatcgtgcgcttctatgacttc
tgggagtccagcgccaagggcaagcggtgcattgtgctggtgacggagctgatgacctcg
gggacactgaagacgtacctgaagcgattcaaggtgatgaagcccaaggtactgagaagc
tggtgccggcagatcctgaagggcctgctgttcctgcatacaaggacaccccccatcatc
caccgagacctcaagtgtgacaacatctttatcactggacccactggctctgtgaagatt
ggtgacttgggtctggccacccttaaaagagcatcatttgccaaaagtgtgataggtacc
cccgagttcatggcacccgagatgtatgaggagcactacgacgagtctgttgatgtctac
gccttcggaatgtgcatgctggagatggccacctccgagtatccctattccgagtgccag
aacgccgcccagatctatcgcaaggtcacctgtggcatcaagccggccagcttcgagaag
gtgcatgatcctgagatcaaggagatcatcggggagtgcatctgcaagaacaaagaggaa
aggtatgagatcaaggacctgctgagccacgccttcttcgcggaagacacgggtgtccgg
gtggagcttgcagaagaggaccatggcaggaagtccaccatagccctgcggctttgggta
gaagaccccaagaagctgaagggcaagcccaaagacaatggagccatagagtttaccttt
gacttggagaaggagacccccgatgaggtggctcaggagatgattgactctggatttttc
catgagagtgatgtgaagattgtggccaagtccatccgtgaccgggtagcgctgattcag
tggcggcgggagaggatctggcctgcactacagtctcaggagccaaaggactcgggcagc
cctgacaaggccaggggtccaccagcacccctgcaggtccaggtgacctaccatgcacag
ggtggacagcctggacagccagaacctgaagaacctgaggccgaccagcacctcctgccc
cctaccttgcctgctagtgttacctccttagcctcggacagcaccttcgacagtggccag
ggctccaccgtgtactccgactcccagagcagccagcagagcatggtgctcagctccctt
gtggacacggctccaaccccagcgtcctgtgtgtgcagcccccccgtgagtgaggggcct
ggcctgacccacagcctgcctgcactgggggccttccagcagccagccgccgtgcctggc
ctgtcagtgggccctgtgccgtcccctgcccgccctccgctgctccagcagcattttcca
gaaccttccatgagctttgcccctgtgttgccaccacccagcacccctgtgcccacgggc
ccaagtcagccagcacccccggtccagcagcctcttccaatggcccagccacctaccctg
ccacaggtcctggccccgcagcccatgggcactgtccagccagtgccctctcacttgcct
ccgtacctggctccagcctcccaggtggtggcccctgctcagctgaagcctctccagatg
ccgcagcctcttgctcaagtccctccgcagatgcctccgatgcctgtggttccccccatc
actcccttgaccggactcgatggcctcccccagaccctcactgacctgccagctgcgaat
gtggcccccgtgccaccacctcagtatttctcacctgctgtgatcttgccaagcctcaca
acgcccctgcccacatcaccggccctgcctctgcaggctgtcaagctgcctcatccccct
ggagcgcccctggctatgccctgccagaccatcgtgccaaatgcaccagctgctatcccc
ctgctggctgtggccccgcagggtgtggctgccctgtccatccatccagcagtggcccag
atcccagctcagatcccagcccagcccgtgtaccccgcagccttcccgcagatggctccc
gcagacatcccgccctcaccccaccacacggtgcagagcttacgggccacccctccacag
ctggcctcacctgtgcctcctcagcctgtccagcccagtgtcgtccatctgcctgagcag
gctgctccaactgctgcctcagggacccaggtcctgctgggccaccctccttcgtatacc
gcggatgtcgctgctccagtctctgctgtgtccctgccgcctgctgtcctttcccctcct
ctgccagacactctgctgcctgctgcccctgagctcctgcccaagctccccagctccctg
gcccctgcagtggtcgcagcctcacagagtgtgcctgcccagacctctacgctcctccca
ccagcaaacccacctctgtctgccgggcctgccgctgctggcccctgccctgctgtccag
ctgacggtggaagctgccccagaggagcaggtttcacaggacaagcctgctggcccccca
cagagctgtgagagttttggaggttctgatgtcacctccggaagagacctgagtgacagc
tgtgaaggttcctttggagggggcaggctggagggcagggctgcccggaaacaccaccgt
aggtccactcgtgcccgctcccggcaggaaagggccagtcggccccggctcactatcctg
aatgtgtgtaacacgggggacaagatggtggagtgtcagctggaaacgcataaccataag
atggtgaccttcaagtttgaccttgacggggacgcccctgatgagatcgccacatacatg
gtagagcatgacttcatcctgcccgctgagagggagacgttcatcgaacagatgaaggat
gtcatggacaaggcagaggacatgctcagtgaagacacggatgttgatcacggctctgat
acagggaccagccctccacacctgggtacctgtggtctggccacgggggaggagaacgga
cagtcccaagccaatgcccctgtctatcagcagaatgtcttgcacacggggaagaggtgg
tttatcatctgtccagtggctgaacacccagcagcagacacttctgaatcatcaccccca
cttcctctaagctccttacagccagaagccagtcaagagccagcgccctttccagaccag
ccgtccttgaaggacagacctagtttcccagctgcgcagcagctcctgagccaggcaggc
tccagcaacccccctggtggagcctcaacccccttggccccatcttcccctcctgtgacc
actgtaatcccggcagcaccagccaccagcaccgtgccagagtcggcagcagggactgcc
aagcaggcagggggtccagggacccaccagggaccagccagtgtccatgagaccctccag
ccactggtcgagactcaccatgcccagcgtgctgcccagccccttagcacgggccaagga
ccttgcaccccagccccagaagcctctcagtgctctacaggtctgggggaggccatctca
accagggaggtcagcactgcaggggagcccttgcctgctggagtgccagagcccagccct
cccactggggccacacagcctgtatcgggtcagccgccacccccactgcccatcacagtg
gggactatcagcctggctgctccccagctccccagtcccccgctgggacccgctgctccc
ccaccaccaccctcagccttggaatcagatggggaagggccgccccccagggtgggcttc
gtggacaacaccatcaagagcctggatgagaagctgcggacactgctctaccaggagcat
gtgcccacctcctcagcctcggctgggacccccatggaggcaagcgatagagagttcacc
ctggagcccctgcgaggagacccgcccgcagccctgagtgacaggaccccaggcctcacc
cagcaggcccacccctcgttggaaaagtcagaaacggcccctgcaggatgggccctgacc
cagcgggagcagggtgcgtcttctccaatgacagcagagtcatcttccagcaacacactg
ggctgtgacagtgacacggggcaggtggcctcggactcccccacggcacccagtgtcccc
caggatgcccctgtttcttccgcccctatgcacatggatcccaaagatcagagcactagt
gttcccagagaagccttggcagcccccgtgcagagctgcccagggaccttcacagagggc
agcccagcccagatgcgtggcgctcgggtctccgggtcccctcacaagcggccagggcag
caggacagcagttctccagccaaaatggtgggccgcttctcggtggtcagcacacaggac
gagtggactctggcgtcgcctcacagcctgcggtactctgccccacccgacgtctacctg
gacgagatcccctccagccctgacgtgaagctggccgtgcggcgggtgcagaccgcctcc
tccattgaggttggcgttgaggagcctgcctccagtgactctggggatgaatgcccgagg
aggaggccccaggtacagaagcaggcctccctgccaggcagcggcagtgtggcaagtgac
tttgtgaagaaggccactgccttcctgcacaggtcttcaagggctggctcgctgggccct
gagacacccagcagggcgggtgtgaaggtccctaccatcagcatcacctccttccactcc
cagtcctcctacatcagcagtgacaatgactcggaatttgaggacgcagacataaagaag
gaactacgcagtcttcgggaaaagcacctgaaggagatctctgagctacagagccagcag
aagcaggagattgaagccctgtacagacgcttgggcaagccactccctcccaatgtgggg
ttcttccacacggcaccccctatgggccgaaggagaaaaaccagcaagagcaaattgaag
gcgggcaagctgctgaaccccctggtgcagcagctcaaggtcgtggcctccagcacaggt
catttgtctgactccagcagaggccctcctactaaggaccctgcccacgccagcacgccc
ccgggcaccaaggcagttcagacccagcagccctgctccgtccgggcctccctgtccaca
gacatctgctccggtttagccaatgatggaggcggagctcatggccaaggctggacggtt
aaccacccaacgtctgagagaggggcctataagtctagtagcaagcctcgtgctcgattc
ctcagtggacccgtatctgtgtccatctggtcagccctgaagcgtctctgcctaggcaaa
gaacacagcagtaggtcttccaccagcagcctggccccaggccctgagccaggtccccag
cccaccctgcacgtccaggcgcaggtgaacaacagcaacaacaagaaaggcaccttcacg
gacgatctgcacaagctggtggacgagtggacagcgaagaccgtggggacggcacagctg
aagcccacgctcaaccagctgaagcagacgcagaagctgcaggacatggaggcctctggc
gaggcacgggctacaactgtgcctcgagcaggagcggggacaccttgtctggccccagca
cccggccctctgtctgccacagccattcctggagccatcccagccctgcctgtgcccaca
ccaggtactgcccactccagcgcctcaggccctccttgtgcactgcctctgagtcagtat
gaaggcctgctccccgttcctgtgtcttgggggccctgggtggcctcagggaacccacag
gggtctgggggcagtcagagccccactcgggtccctatgctgccggtgttcctacggcca
cctgttatcagcacgccaggcccccggctgcacatcacgtag

DBGET integrated database retrieval system