KEGG   Meriones unguiculatus (Mongolian gerbil): 110549244Help
Entry
110549244         CDS       T05884                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04218  Cellular senescence
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04390  Hippo signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05140  Leishmaniasis
mun05142  Chagas disease (American trypanosomiasis)
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05321  Inflammatory bowel disease (IBD)
mun05323  Rheumatoid arthritis
mun05410  Hypertrophic cardiomyopathy (HCM)
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110549244 (Tgfb2)
   04350 TGF-beta signaling pathway
    110549244 (Tgfb2)
   04390 Hippo signaling pathway
    110549244 (Tgfb2)
   04068 FoxO signaling pathway
    110549244 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110549244 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110549244 (Tgfb2)
   04218 Cellular senescence
    110549244 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110549244 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110549244 (Tgfb2)
   05206 MicroRNAs in cancer
    110549244 (Tgfb2)
   05205 Proteoglycans in cancer
    110549244 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110549244 (Tgfb2)
   05212 Pancreatic cancer
    110549244 (Tgfb2)
   05225 Hepatocellular carcinoma
    110549244 (Tgfb2)
   05226 Gastric cancer
    110549244 (Tgfb2)
   05220 Chronic myeloid leukemia
    110549244 (Tgfb2)
   05211 Renal cell carcinoma
    110549244 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110549244 (Tgfb2)
   05321 Inflammatory bowel disease (IBD)
    110549244 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    110549244 (Tgfb2)
   05414 Dilated cardiomyopathy (DCM)
    110549244 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549244 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110549244 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110549244 (Tgfb2)
   05161 Hepatitis B
    110549244 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110549244 (Tgfb2)
   05144 Malaria
    110549244 (Tgfb2)
   05145 Toxoplasmosis
    110549244 (Tgfb2)
   05140 Leishmaniasis
    110549244 (Tgfb2)
   05142 Chagas disease (American trypanosomiasis)
    110549244 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110549244 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110549244 (Tgfb2)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110549244 (Tgfb2)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110549244 (Tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 110549244
NCBI-ProteinID: XP_021493906
Position
Unknown
AA seq 414 aa AA seqDB search
MHYCVLRTFLLLHLVPVALGLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEHYPEP
GKVPTEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSENAIPP
TFYRPYFRIVRFDVSPMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGPSTYAGGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLEPQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
TRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgcgtgctgagaacctttttgctcctgcatctggtcccggtggcgctcggt
ctgtctacctgcagcaccctggacatggaccagtttatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggagcactaccctgagccg
ggcaaggtccccacggaggtgatttccatctacaacagtaccagggacttactgcaggag
aaggcaagccggagggcagccgcctgcgagcgcgagcggagcgacgaggagtactatgcc
aaggaggtttataaaatcgacatgccgtcccacttcccctccgaaaatgccatcccgccc
actttctacagaccgtacttcagaatcgtccgcttcgatgtctccccgatggagaagaat
gcttctaatctggtgaaggcggagttcagagtgtttcgcttgcagaaccccaaagccaga
gtggctgaacaacggattgagctctaccagatcctcaagtccaaagacttaacatctccg
acccagcgctacatcgacagcaaggttgtgaagaccagagcggagggcgagtggctgtcc
ttcgatgtcactgacgcagtgcacgagtggcttcaccacagagacaggaacctgggattt
aaaataagtttacactgcccctgctgtactttcgtgccatcgaataattacatcatcccg
aataaaagcgaagagctagaggcgagatttgcaggtattgatggcccctccacatatgcc
ggtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagactggagccacaacagtccaacaggcggaag
aagcgtgctttggatgccgcctattgctttagaaatgtgcaggataattgctgccttcgg
cctctttacattgatttcaagagggatcttggatggaaatggatccatgaaccgaaaggg
tacaatgctaacttctgtgctggggcgtgcccatatctttggagttcagacactcagcac
accagggtcctcagcttgtataacaccataaatccggaagcttctgcttccccttgctgc
gtgtcccaggatctagaaccgctgaccatcctctactacattggaaacacacccaagatc
gaacagctttccaacatgatcgtcaagtcctgtaaatgcagctaa

DBGET integrated database retrieval system