KEGG   Meriones unguiculatus (Mongolian gerbil): 110549316
Entry
110549316         CDS       T05884                                 

Gene name
Tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00100  Steroid biosynthesis
mun01100  Metabolic pathways
Module
mun_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110549316 (Tm7sf2)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110549316 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 110549316
NCBI-ProteinID: XP_021494055
Position
Unknown
AA seq 418 aa
MTLREASQAPLEFGGPLGVAAMLVLLPATVFHLLLVARSGPARLLAPPPYLPGLEELWSP
PALLLLFIWLGLQVALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLVGLGLLAG
LPLGALPGMLLPLAFATTVTSFIFSFLLYAKALVAPASALAPGGNSGNPLYDFFLGRELN
PRLGSFDFKYFCELRPGLIGWVFINLALLMQEVELRGSPSLAMCLVNGFQLLYVGDALWY
EESVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLIKVIG
YYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYLFYFTALLVHREARDEQQCLHKYGHAWQEYCKRVPYRIIPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgactcttcgtgaggcctcccaggcccctctggaattcggggggccgttgggcgtcgca
gcgatgctggtcctgttacctgccactgtgttccacctgctcctggtggcccgctctggc
ccggcgcgcctcctggccccaccaccatacctgcctggcctggaggagctctggagtcca
cctgctctgctgctattgttcatctggctcggcctgcaggtggcgctctacctgctgcct
gcgcgcaaggtggccgaagggctggaactgaaggacaagagtcgcctgcgctaccctatt
aatggcttccaggctctggtgctaacagccctgttggtggggctgggcctgttagctggg
ctgcccctgggggcactccctggaatgctcctgcccttggcatttgcgaccaccgtcacc
agctttattttcagctttctcctctatgcgaaggcattggtagctcctgcctcggccctg
gctcctgggggaaactcaggaaatcccttgtatgacttctttctgggacgagagctgaac
cctcgccttggttcctttgacttcaaatatttctgtgagctgagacctggcctcatcggc
tgggtcttcattaacctggccctgctaatgcaggaggtggagctgcgggggagtccttca
ctggccatgtgtctggtcaatggcttccagttgctgtatgtgggtgatgccctctggtat
gaggagtctgtcctcaccaccatggacataatacatgatggttttggcttcatgctggcc
tttggagacctagcctgggtaccattcacctacagcctgcaggcccagttcctgctatac
catccacagcctctggggttgcccatggccttgctcatctgcctcattaaggttattggt
tactacatcttccgtggggccaactcccagaaaaacacattcagaaagaatccttctgac
cccagtgtggcaggtcttgagaccatccctactgccacagggaggcagctgctggtgtct
gggtggtggggaatggttcgtcaccccaactacctgggagatctcatcatggctctggcc
tggtccttgccctgtggggtgtcccacctgctgccctacttctacctcttctacttcact
gccctgctggtgcaccgggaggcccgagatgagcagcagtgcctccataagtatggccat
gcctggcaggaatactgcaagcgtgtgccttaccgaatcataccctatgtctactga

DBGET integrated database retrieval system