KEGG   Meriones unguiculatus (Mongolian gerbil): 110550326Help
Entry
110550326         CDS       T05884                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00260  Glycine, serine and threonine metabolism
mun01100  Metabolic pathways
mun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110550326
Enzymes [BR:mun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110550326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 110550326
NCBI-ProteinID: XP_021495813
Position
Unknown
AA seq 391 aa AA seqDB search
MLCRLARTAVPGLKVPCAQWSGNWAGVPAHVVDLRSDTVTRPGPAMRRAMAEAAVGDDDY
GEDPTVHELQEKAAKLLGVERTLFVPTNTMANLISVMGHCRRRGSQVILGQECHLNVYEQ
GGVAQIAGVHSHPLPDLPQGTLDLNELERALTRGFGSAYHPVCELVCLENTHNIAGGRVL
PIDYLRQVRLLAHAHGARVHLDGARLMNAAVALRVPPAHLVEHCDSVSFCFSKGLGAPVG
AVVGGSKDFIEEAWRLRKALGGGMRQAGVLAAAALVGLEESEEVLPRDHENARRFAEGLQ
ELASPVCSVNPATVETNMVLVHVAGLPPTELCQRLQAVSAEEVAQTGRAVRVLLFPWTGR
SVRAVWHRDVSAQDTELALRKWEFVLRQLEP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcagactggcccggactgctgtcccagggctcaaggtgccctgtgctcagtgg
tctgggaactgggcgggggtcccagcccacgtggtggacctgcgcagcgacactgtgact
cggccaggcccggccatgaggcgagccatggccgaggcggccgtaggagacgatgattac
ggcgaagatcccacggtccacgaactgcaggaaaaggctgcaaagctgctcggagtggag
cggaccctgtttgtgcccaccaacaccatggccaacctcatctctgtgatgggtcactgc
cggcgccggggttcccaggtcatccttgggcaggaatgccacctcaacgtctatgagcag
ggcggagtggctcagatcgctggggttcactcccaccccctcccagacctgccccaaggc
accctggacctgaatgagctagagagggcactgactcggggcttcgggagcgcctaccat
ccggtctgcgagctcgtgtgcctggagaacacgcacaacatcgcagggggccgggtctta
cccatcgactacctccgccaagtgcgcctgctggcccatgcccatggagcgcgggtccac
ctggacggggcgcggctgatgaacgcagctgtggctctgcgtgtgcctcccgcccatctc
gtggagcactgtgactctgtgtccttctgcttctctaaggggcttggcgcaccagtcggg
gctgtggttgggggatccaaagacttcattgaggaggcctggcgcctccgaaaggccctg
ggtggaggcatgcggcaggctggagtgctagctgcggctgccctggtgggactggaggag
tccgaggaggtgctgccgagggaccatgagaatgcgcggagattcgctgaaggactccaa
gagctggcgtcacccgtttgctctgtgaaccccgccaccgtggagaccaacatggtgctg
gtacacgtggctggactgcccccgacggagctgtgccagcgcctccaggctgtgagcgcg
gaggaggtggcacagactggccgtgccgtgcgcgtgctgctgtttccctggacgggacgg
tctgtgcgggccgtgtggcacagagatgtgtctgctcaggacacggaactggcactgagg
aagtgggagttcgtgctgagacagttggagccctga

DBGET integrated database retrieval system