KEGG   Meriones unguiculatus (Mongolian gerbil): 110551644Help
Entry
110551644         CDS       T05884                                 

Gene name
Mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00450  Selenocompound metabolism
mun00970  Aminoacyl-tRNA biosynthesis
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110551644 (Mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110551644 (Mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mun01007]
    110551644 (Mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mun03016]
    110551644 (Mars2)
Enzymes [BR:mun01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110551644 (Mars2)
Amino acid related enzymes [BR:mun01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110551644 (Mars2)
Transfer RNA biogenesis [BR:mun03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110551644 (Mars2)
 Prokaryotic type
   Other AARSs
    110551644 (Mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 110551644
NCBI-ProteinID: XP_021498029
Position
Unknown
AA seq 586 aa AA seqDB search
MLRQCALRVLRGPRAGHGCCRYSSCSPSASGDAREARAYFTTPIFYVNAAPHIGHLYSAL
LADALCRHRRLRVPGSASTRFSTGTDEHGLKIQQAAATAGLAPGELCDRVSAQFQQLFRE
AGISSTDFIRTTEARHRVAVQHFWGLLEARGLLYKGIYEGWYCASDECFLPEAKVTRQVG
PSGDPCPVSLESGHPVSWTKEENYIFRLSQFREPLQQWLRNNPQAITPEPFHRAVLQWLE
EELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVAGYPDAEFKSWWPATSHI
IGKDILKFHAIYWPALLLGAGLRPPHRICVHSHWTVSGQKMSKSLGNVVDPRTCLDRYTV
DGFRYFLLRQGVPNWDCDYYDEKVIKLLDSELADAIGGLLNRCTVHRINPSGIYPTFCAA
CFPREPGGTGPSVRVQAEDYELVNAVATLPKQVAGYYDAFQIYKALEAVSSCVRQTNSFV
QRHSPWKLTWESPADAPWLGTVLHVALECLRVFGTLLQPVTPNLSDKLLSRLGVSATERG
LGELDFLPRFYGRPSPFEGRRLGPDTGLLFPRLDQSRTWLGKADRT
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcagtgcgctctgcgggtgctgaggggcccccgcgcggggcacggctgttgc
cgctacagctcgtgctcgccgagcgccagcggcgacgctcgagaagcgcgggcctacttc
acgacccccattttctacgtgaacgccgcgccgcacatcgggcacctgtactcggcgctg
ctggccgacgccctgtgccgccaccgtcgtctccgcgtccccggctccgcgtccacgcgg
ttttccaccggcacggacgagcacggcctgaagatccagcaggcggcggccaccgcgggc
ctggccccaggcgagctgtgcgaccgagtgtctgcccagttccagcagcttttccgggag
gctggcatctcctccaccgacttcatccgcaccacggaggctcggcacagagtggcggtg
cagcacttctgggggttgctggaggcccggggtctgctttacaaagggatctatgaaggg
tggtattgcgcctccgacgagtgcttcctgcccgaggccaaggttactcggcaggtgggt
ccgtccggggatccatgtcctgtgtctctcgagagcggacaccctgtctcctggaccaag
gaagaaaattacattttcaggctttcccagtttcgagaacctctccagcagtggcttcga
aacaacccgcaggcgatcaccccggagccgttccaccgggcagtccttcagtggctggag
gaggagctgccggatttgtcggtttctcggaggagtagccacctgcactggggcattccg
gttcccggggacgactcgcagactatctacgtgtggctggatgccctggtcaactacctc
actgtagctggctacccagatgcagagttcaagtcttggtggcccgccacatcacatatc
ataggtaaggacattctcaaatttcatgctatttactggcctgcccttctcctaggggcc
ggattgaggccaccccatcgcatctgtgtacattcgcactggacggtgagtggccaaaag
atgtccaagagcttgggcaacgtggtggatcccaggacttgccttgatcggtatactgtg
gatggcttccgctacttcctccttcggcagggtgttcccaactgggactgcgactattat
gatgaaaaggtgattaaactgctggactccgagctggcagatgccataggagggctttta
aaccggtgcaccgtgcacagaataaacccttctgggatctacccgactttctgtgctgcc
tgtttccccagggagccagggggcacgggcccgtcagttcgtgtgcaggcagaagactat
gaactcgtaaatgcagtggccactttgcccaagcaggtagcgggctattatgatgccttt
cagatctataaggctctggaggcggtatccagctgtgttcgtcaaactaatagtttcgtc
caaaggcactcaccgtggaaattgacctgggagagccctgctgatgctccctggctgggt
accgtgcttcatgtggccctggagtgtttgcgagtgtttggaactttgcttcagcctgtt
actcccaacttatcggataagctgctttcaagacttggggtctctgccactgagagaggc
cttggggagctcgacttcctacctcgattctatggacgcccaagcccttttgaagggaga
aggttgggacccgacactgggcttttgtttcccagactggaccagtccaggacttggcta
gggaaagccgacagaacctag

DBGET integrated database retrieval system