KEGG   Meriones unguiculatus (Mongolian gerbil): 110552298Help
Entry
110552298         CDS       T05884                                 

Gene name
Espl1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04110  Cell cycle
mun04114  Oocyte meiosis
mun05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110552298 (Espl1)
   04114 Oocyte meiosis
    110552298 (Espl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110552298 (Espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110552298 (Espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110552298 (Espl1)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     110552298 (Espl1)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C50: separase family
   110552298 (Espl1)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    110552298 (Espl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 110552298
NCBI-ProteinID: XP_021499164
Position
Unknown
AA seq 2105 aa AA seqDB search
MRNFKGVNFAALLCSKEGAQDLLPDLKEFLSKSRPDLPSNRSDAERRQVCDAVLRACNQQ
LTAKLECPGHLRTVLDLAELACEGYLLSTPQRPPLYLERILFILLRNGLAQGSPDTVLCL
AQPLHACLVQSCPEAAPQDYMLVTRGSFSLLWKGAEAVSERRAALLTRLKALSFLVLLED
DSAPCEVPHFASPTACRVVAAYHMFDAGGRGLDEADADFLYDLLSRHVIRVLVGGAGGSM
GSLSPQRALCLLELTLEHCRRLCWSHYLHKATRAVEKAHGHLQSSSVAPGLQLCQVAVEL
LDAAEKRPGAVAQLLKKAAAILNNSMAAPAPPLRALYDSCQFFLSVLERGTKRHCGLHGT
LSFFAFLGGYCSVVRQLRDVSDASSKQQQCLLQVHFQALHLLTGMVYDFAQGCQAAELAQ
LVDGCRSAVAWMLEALEGLTGGELAEYLGMTASYSSNLAYSFFSHKLYNEACAISEPVCQ
HLGLAKSGACPEVPPEKLHRCFRLHVESLKKLGRQAQGCEMVTLWLAALQPYSLEHMAEP
VTYWVRVKMDAARAGNKELQLRTLRDSLSAWAPETQVLLLREELQAYKAVRADTGQERFN
VICDLLELSPEETAAGAWARATHLLELAQVLCFHSFAQQTNCSALDAVQEALQLLESVRP
EAQEQDRLQDDKAQALLWLHICTLEAKMQEGIERDRRAQAPSDLEEFEVNDLNYEDKLQE
DRFLYSNIAFNLAADAAQSECLDRALALWKEVLMKGSAPAVRSLQQTAASLQILVALYQL
VAKPLQALETLLLLQTVCERLQDHAKAVSASCQLTQQLLSLGCPGYAQSYLEAAESSLKS
LDQTTDVCQLLSLTCALLRSQLCWACQKVPEGVSLLLSVLGDPALQKSSKAWYLLRVQAL
QVLALYLSLSANVLPSALREQLWDQGWQTPETALLDAHKLLRSIVILLMGSDVLSTQKTT
VESTFLDFGENLVQKWQVLTEVLSCSEKLVSRLGRLGSVSEAKAFCLEALKLTTKLQIPR
QCALFLVLKAELELARSDSDLCESDLQQVLFLLESSTEFAAVTQRPDSVKKVYMQKGKQR
AQVPCFPLLPEEEPFLRGPALELVATVPREPGPIQPSANSSPVLKTKPPPKPGFLSHSSS
CDCSLCASPGLSAVCLRWVLVTAGLRLATGHKAQGLELLQLVLKGCPAATRRFTQRLQAS
LRHTAPPSSTPSLFDEIMAQVYTHLALEHLNQTSEKSLGKVLTLGLKFVAARIQCLEFWQ
ASLLLVQALAKLASFSCCGTQLFASTWGWQPPLIKSPKVVEPSKTRRQKCSGRGLRQAAS
APPPLHNSAQRVLEEEGPPCTPKPPGRARPASARVPFTIFEEVHPTKSKPDAPLAPRVHR
RAQTRLRVSFSDDSDLEDLVAEPQPVEEVRRRGTRGRGQMRKGPGLKTDAAVGTGSGPGR
SSVSGISGRSRRAKKEVPRRCEEETAKTSVCVRASVGPEVMRAIPEENLTDSRLEMSFEI
LRGSDGEDGAAGEREVLRRDSSKAEHSVLYPDKEPASDPRPWLRPLSVPVPIDLSTLESI
SDSLSVAFRAVSHCPPSGLYAHLCRFLALCLGQRDPCATAFLVAESVSITCRHQLLTHLH
RQLSKAQKQQGAPELAERLQGLDLKERPGSVPLARIQRLFSFRTWGSGCFPQAEKDDFQE
RLAQLPSGVTVCVLALATLQPGTLSNTLLLTRLEKDNPPVTVKIPTAQNKFPLSSVLREF
DAIQKDQKENSSCTEKRAWWTGRLALDQRMEDLITSLEESVLGCWRGLLLPCSSEPGPAQ
EASRLQELLRDCGWEYPDCTLLKVILSSARTLSSQDVQALAYGLCPAQPERARVLLSEAV
ERVQSQAAPGNQHLVLVLDKDLQKLPWESMPVLRALPVTRLPSFRFLLSYSITKEAGASS
VLSHGVDPQNAFYVLNPHSNLSSTEERFRASFSSEAGWKGVIGEVPSLEQVQAALTERDL
YVYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVHGNLEGAGIVLKYIMAGCPLF
LGNLWDVTDRDIDRYTEALLQGWLRAGPGAPLLCYVSQARQAPRLKFLIGAAPIAYGLPV
SLQAP
NT seq 6318 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacttcaaaggagtcaacttcgcggctctgctctgcagcaaggagggggcccag
gacctgttgcctgacttgaaggagttcctgtccaaatctcgacctgatcttcccagcaac
cgatctgacgctgagagaagacaagtctgtgacgctgtcctgagggcttgcaaccagcag
ctgactgccaagcttgagtgccctgggcacctgaggactgttctggacctggcggagctg
gcctgtgagggttatttgctgtccaccccgcagcgcccgcccctctatctggagcgcatt
cttttcatcttactccggaatggcttggctcagggaagcccggacaccgtgctgtgcctt
gcccagcctctccacgcctgcttggtacagagctgtccagaggccgcccctcaggattat
atgctcgtgacacggggcagtttctctctgctttggaagggagccgaggccgtgtcagag
cggcgagctgctctcttgacccggctgaaggccctgagcttcctggtgctcctggaggat
gacagtgctccctgtgaggtgcctcactttgcctcaccaacagcctgcagggtggtggct
gcctatcatatgtttgatgccggcggacgtgggctagatgaagccgacgctgacttccta
tatgacctgctctctaggcatgtgatcagagtcttagtcggcggggctggtggctctatg
ggttctctttctcctcagagggccctctgcctcttggaactcaccttggaacactgccgt
cggctctgctggagccactacctccacaaggcaaccagagcggtggagaaggcccatggt
cacctgcagagcagcagtgtagctccgggcctccagctatgtcaggtggcggtcgagctg
ctggacgctgccgagaagcgccccggggcagtggcccagctcctgaagaaggcggcagcc
attctgaacaacagcatggcagcccccgcgcccccgctccgggccttgtatgacagctgt
cagtttttcctctcggtcctggagagaggcaccaagaggcactgtgggctccacggcacc
ctgagcttctttgcttttcttgggggatactgctccgttgtccggcagcttcgagatgtc
tctgacgcgtcctccaagcagcagcagtgtctactccaggtgcacttccaggctcttcac
ctcctcactgggatggtttatgactttgcccaaggctgccaggcagccgagctggcccag
ttagtggacggttgcagatctgcggttgcctggatgctggaggccttagagggcctgaca
ggcggagagctggctgagtacctgggcatgactgcctcttactcgagcaacttggcctac
agcttctttagtcacaagctctataatgaggcttgtgccatctcggagccagtctgtcaa
cacttgggcctggcaaagtcaggtgcttgccctgaggtgcctcctgagaagctgcatagg
tgcttccggctgcatgtggagagtctgaagaaactgggtagacaggcccagggctgtgag
atggtgaccttatggctggcagctctgcaaccctacagcctggagcacatggccgagcca
gtcacttactgggttcgcgtcaaaatggatgcagccagggcaggaaacaaggagctgcag
ctgaggactctgcgagacagcctaagtgcctgggccccggagacgcaggtcctgctgctg
agggaggagctgcaggcctacaaagcagtgcgggctgacactggacaggaacgcttcaac
gtcatctgtgacctgctggagctcagccctgaagagacagcagctggagcctgggcacgg
gccacccacttgttggagctggcccaagtgctgtgcttccacagctttgcccagcagacc
aactgctctgccttggatgctgtccaggaggccctgcagcttctagagtcagtgaggccc
gaggcacaggagcaggaccgccttcaggatgacaaagcccaggccctgctgtggctccac
atctgcaccttggaggccaaaatgcaggaaggtattgagcgggatcggagagcccaggcc
ccgagtgacttggaggagtttgaagtcaatgacctgaactatgaggataaactccaggaa
gatcgttttctgtacagtaacatcgcctttaatctggccgccgatgccgcgcagtctgag
tgcctggaccgagcgctggccctgtggaaggaggtgcttatgaaggggtctgccccagcc
gtgcggagcctgcagcagacggcagcctccctgcagatcctggtggccctctatcagctg
gtggcaaagcccctgcaggctctggagaccctcctgctcctccagactgtgtgtgagaga
ctgcaggaccatgcaaaggcagtcagcgcttcctgccagctcacccagcaactcctgagc
ctcggctgccccggctatgcccagtcatacttggaagcagcagaatcaagcctgaagagt
ctcgaccagactactgacgtgtgccagctcctttccctgacctgtgctctgcttcgaagt
cagctctgctgggcttgccagaaggtgcccgagggtgtttctctgttgctttctgtcctt
ggggaccctgccctgcagaagtcatccaaggcttggtacttgctgcgcgtccaggccctg
caagtcctggctttgtatctcagcctctcggccaacgtcctcccaagtgccctgcgcgag
cagctctgggatcaaggctggcagaccccagagacggccctgctggacgcccacaagctg
ctgcgcagcattgtcatcttgctgatgggcagcgacgtgctctctacccagaagaccact
gttgagtcaaccttcctggacttcggtgaaaatttagtgcagaagtggcaggttctaaca
gaggtgctgagctgctcagagaagctggtcagccgcctgggccgcctggggagtgtgagc
gaggccaaagccttctgtttggaggccctgaaactcacgaccaagttgcagatacctcgc
cagtgtgccctcttccttgtcctgaaggctgagctggagctggctcgcagcgacagtgac
ctctgtgagtcagacctgcagcaggttctattcctgctggagtcctccacagagtttgct
gcagtgacccagcgcccagactctgtgaagaaggtgtatatgcagaaggggaagcagagg
gctcaagtaccctgttttccactgctgccagaggaggaacccttcctgagaggccctgcc
ctggagctggtggccactgtgcccagggagcccggccccatccagccctctgcaaactcc
tccccagtcctgaagaccaagccgccacccaagcctggctttctgtcccactcctccagc
tgcgactgctcgctgtgtgccagccctggcctctcagccgtctgtctgcgctgggtgtta
gtcactgcaggactgaggctggccacgggccataaggcccagggtctggagctgctgcag
ctcgtgctgaagggctgccctgcagccaccaggcgcttcacacagagacttcaggcctct
ctgagacacacagcacccccctcttccacgccaagcctcttcgatgagatcatggcccaa
gtgtacacacacttggcactggaacacctgaatcagacctctgaaaagagcctggggaag
gtcctgactttggggctgaagttcgtggcagcacggatacaatgcttggagttctggcaa
gccagcctgctcttggttcaggcccttgcgaagctggccagcttcagctgctgtggtacc
cagctttttgcaagcacttggggctggcagccaccattaataaaaagtcccaaagtcgta
gagccctctaagactcggagacagaaatgctctggacgagggctccggcaggcagcctct
gccccgccacccctccacaacagtgcccagagagtcttggaggaggaagggccaccttgt
accccgaagcccccaggccgggctaggccagcgagtgctcgggtccctttcaccatattt
gaagaagtccaccccacgaagagcaagcctgacgctcccttggctcccagagtacatagg
agggcgcagactcgcctcagggtgagcttcagtgatgacagcgacctggaagaccttgta
gccgaaccacaacctgtggaggaagtgagaagacgagggacccggggccggggccagatg
aggaagggtcctggcttgaagacagacgcagcagttggcacaggtagtggccctggacgg
tcaagtgtcagtgggatcagtgggaggagtcggcgggccaagaaggaggtaccaagacgt
tgtgaagaagagactgccaagacatccgtctgtgtccgggccagcgtgggacctgaggtc
atgagagccatccctgaagagaatctgacggacagccggctggaaatgagctttgagatt
ctcaggggttctgatggggaagacggcgctgcaggagaacgggaggtgttgagacgggac
tccagcaaggcagagcattctgtcctgtacccggacaaggagcccgctagtgaccctcga
ccttggctgcggcccctttcagtccctgtgcccattgatctctctaccctggagtccatc
tccgactcgctgagcgttgctttccgcgctgtcagtcactgcccgcccagcggcctctac
gcccacctctgccgcttcttggccttgtgtctgggccagcgggatccctgtgccactgcg
ttcctcgtcgctgagtccgtctccatcacgtgccgtcaccagctgctcacccacctgcac
cgacagctcagcaaggcccagaagcagcaaggagctcctgaactagcagagcgcctccag
gggctggacctgaaggagaggccagggagtgtccccctggcccgcatccagcgcctcttt
tccttcaggacttggggatctggctgcttcccccaggcagagaaggacgatttccaggag
cgcctggctcagctccccagtggggtcactgtctgcgtgttggccctggccaccctccag
cctggaacgctgagcaacactctcctactgacccgactggaaaaggacaaccccccagtt
accgtcaagatccccaccgcccaaaataagttcccactaagctcagtgctcagagagttt
gatgccatccagaaggaccagaaagaaaacagcagctgtactgagaaacgagcatggtgg
acggggcggctggcactggatcagaggatggaggacctcatcacctccctggaggagagc
gtgctgggctgctggaggggcctgctgctgccctgcagttcggagcctggccctgctcag
gaggcctcccggctacaagagctgctgcgggactgtggctgggagtaccctgactgcacg
ctcctcaaagtcattcttagcagtgccagaaccctcagcagccaggatgttcaggccttg
gcctatgggctgtgcccagcccagccagagcgtgcccgagtgctcctgagcgaggcggta
gagcgggtgcagagccaggcggccccgggaaatcagcaccttgtattggtgttagacaag
gacctgcagaagctgccatgggagagcatgcccgtcctccgagcactgcctgtcacccgg
ctgccctccttccgcttcctactcagctactccatcactaaagaggctggggcttcgtcg
gtgctgagccacggtgttgatccacagaatgccttctatgtcctaaacccccacagcaac
ctgtcaagcacagaggagaggttccgagccagtttcagcagtgaagctggctggaaagga
gtgattggggaagtgccaagccttgagcaggtgcaggctgccctgacagagcgggactta
tacgtctatgcagggcatggagctggtgcccgcttccttgatgggcaggctgtcctgcgc
ctcagctgccgggcagtggccctgctgtttggctgcagcagcgcggccctcgctgtgcat
ggaaacctggagggagctggcatcgtgctcaagtacatcatggccggctgccccttgttc
ctaggcaacctctgggatgtgaccgacagagacattgaccggtacacagaggctctgctg
cagggctggctccgagcaggcccgggggccccccttctctgctacgtcagccaggcccgc
caggcgccccgacttaagtttctcattggggctgcacccatcgcctatggcctgcccgtc
tctctgcaagcaccttga

DBGET integrated database retrieval system