KEGG   Meriones unguiculatus (Mongolian gerbil): 110554765Help
Entry
110554765         CDS       T05884                                 

Gene name
Pla2g4d
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00564  Glycerophospholipid metabolism
mun00565  Ether lipid metabolism
mun00590  Arachidonic acid metabolism
mun00591  Linoleic acid metabolism
mun00592  alpha-Linolenic acid metabolism
mun01100  Metabolic pathways
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04072  Phospholipase D signaling pathway
mun04217  Necroptosis
mun04270  Vascular smooth muscle contraction
mun04370  VEGF signaling pathway
mun04611  Platelet activation
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04724  Glutamatergic synapse
mun04726  Serotonergic synapse
mun04730  Long-term depression
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04913  Ovarian steroidogenesis
mun04921  Oxytocin signaling pathway
mun05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110554765 (Pla2g4d)
   00565 Ether lipid metabolism
    110554765 (Pla2g4d)
   00590 Arachidonic acid metabolism
    110554765 (Pla2g4d)
   00591 Linoleic acid metabolism
    110554765 (Pla2g4d)
   00592 alpha-Linolenic acid metabolism
    110554765 (Pla2g4d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110554765 (Pla2g4d)
   04010 MAPK signaling pathway
    110554765 (Pla2g4d)
   04370 VEGF signaling pathway
    110554765 (Pla2g4d)
   04072 Phospholipase D signaling pathway
    110554765 (Pla2g4d)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110554765 (Pla2g4d)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110554765 (Pla2g4d)
   04664 Fc epsilon RI signaling pathway
    110554765 (Pla2g4d)
   04666 Fc gamma R-mediated phagocytosis
    110554765 (Pla2g4d)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110554765 (Pla2g4d)
   04913 Ovarian steroidogenesis
    110554765 (Pla2g4d)
   04921 Oxytocin signaling pathway
    110554765 (Pla2g4d)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110554765 (Pla2g4d)
  09156 Nervous system
   04724 Glutamatergic synapse
    110554765 (Pla2g4d)
   04726 Serotonergic synapse
    110554765 (Pla2g4d)
   04730 Long-term depression
    110554765 (Pla2g4d)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110554765 (Pla2g4d)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110554765 (Pla2g4d)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110554765 (Pla2g4d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 ICAT
Motif
Other DBs
NCBI-GeneID: 110554765
NCBI-ProteinID: XP_021503277
Position
Unknown
AA seq 863 aa AA seqDB search
MWSGARSIGMESRSPERLSGHPYQEEAFVFCWLTVKVLEAWNLPWSDLLDPGMALQLPKA
PGVKFKTQTVTSATHPVWNETFSFLIQSXVKNILELTVCAEDLITKDDICFKVSYDVSEI
LPGQLLQKTLNLNPQGPEELDVEFLVERTVDPPENLITNNVLVAQELSQLDIYVDRARNT
TVAAGQDKVELELVLKGSYEGTQTFALDTASTLCFHYVRGWDTELDGNLRSSGNKGWNSE
TIAPSFNVPLTSLAPGKEVTVDIPALNVPEAKLQFKTDCCPKELAVRLGYGLSPEEQAFL
RRRKQVVATALKQALQLDEDLKEDKVPVVAISAEGGGVRSMTSLYGHLLALQKLGLLDCV
TYITGISGSTWTMAHLYQDPEWSXQDLEGLISHTRKHVAKSLLKAFFPEHLVSYRQTLKL
QAEQGHPPSITDLWGLVLAAKLHGKATDQTLSEQRAALERGQNPLPLYLCINVKTNMDTL
HFKEWMEFSPYEVGFLKYGAFIPSELFGSQFFMGWLMKRLPESPVCLLEGIWGNVFSSNL
MDIWCSINSQKDWKFSEDVKNSVTEPSASAGTSSCGDAQWLQPGTALAQAIKGCLTSRLF
YQRSSNFLHGLQLHRDYRNQKDFSRWADSSLDYKLNQLTPQDPHLCIADTGFFMNSSIPS
LLCQDRQVDLILSFSYNQFLPFKGLKQSEKYCSVQGLPFPRVEPSPEDQRQPRECYLFSD
PTCPEAPVLLHFPLVNGSFRDHSAPGVWHSPAELRAGQMDFMGKSSPYTLFSMTYKEEEF
NYLLQLSDYNVRNSQDMILQALKTVLKRRAPEAHHQECRHEASGGGITVSMMVKFGNVEE
NWLCLRMLGAVAPPCRPPVTTEH
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtggagctagaagtattggcatggagagccggtcacctgagagactatctggc
catccttaccaggaggaggcctttgtcttctgctggctcactgtgaaggtcctggaggcg
tggaatttgccctggagtgatcttctggaccctgggatggctctgcagctgccaaaggct
cctggagtaaaattcaagacccaaacagtcaccagcgccactcatcccgtatggaatgag
accttcagtttcctcatccagagttaggtcaagaatattctggagctgacagtctgtgct
gaagacttaattacgaaagatgacatctgtttcaaagtctcctatgatgtctcagaaatc
ctccctggccaactgctccagaaaaccttaaacctgaatcctcagggaccggaagagcta
gatgtggagttcctggtggaaagaacggtggaccctccagaaaatctcatcaccaacaat
gtccttgtggcccaagaactgtcccagctggatatctatgtggacagagccaggaacacc
accgtggcagcaggtcaggacaaagtagagctggagcttgtgctgaaggggtcgtatgag
ggcacacagacatttgccctggacacagcctctaccttatgcttccactatgtgaggggc
tgggacacagagctggatgggaacctgaggagttctggaaacaagggctggaactcagaa
accatagctccatccttcaatgtacccctgacgtccttggccccagggaaggaggtgacc
gtggacattccagctctgaatgtcccagaagcaaagctgcaatttaagacagactgctgc
cctaaggagctagctgtgcggctgggctatggactcagtcccgaggagcaggccttccta
cgcaggaggaagcaggtggtggccaccgccctgaagcaggccctgcaactggatgaagac
ttgaaggaagataaggttcctgttgtggccatcagtgctgaaggaggaggtgtgcggtct
atgacctcactctacggccacctgttggcacttcagaagttgggcctcctggactgtgtg
acctacatcactggcatatcaggctctacatggacaatggcccatctgtaccaggaccca
gagtggtcatagcaggacctcgagggactcatcagccataccaggaagcatgtggctaag
agcctactgaaggcattcttccctgaacacttggtaagctaccgccagacgctgaagctg
caggcagagcagggccacccacccagcataacagacctgtggggcctggtgctggcagcc
aagctgcatgggaaggcgacagatcagacgctgtcagaacagagagctgcactagagcgg
ggccagaaccccctgcccctctacctgtgcatcaatgtcaaaacgaacatggacaccctc
catttcaaggaatggatggagttctctccctatgaagttgggttcctgaaatatggagcc
tttatcccctctgagctctttggctcccagttctttatggggtggctgatgaagaggctt
cctgagtccccagtctgcttattggaaggtatctggggcaacgttttctcttcgaacttg
atggatatctggtgtagtatcaactctcagaaagactggaagttcagtgaggacgtcaaa
aactcagtaactgagccctcagcctcagcaggaacctcctcctgtggggacgcccaatgg
ctgcagcccggaacagccctggcccaggcaattaagggctgtctgaccagcaggctattt
taccagcgtagctccaacttcctccacggcctccagctgcaccgggactaccgtaaccag
aaagacttctccaggtgggcagacagcagcctagactacaagctgaaccagctgacccca
caggaccctcacctctgcatagctgacactggcttcttcatgaacagcagcattccctcc
ctgttgtgccaagatcgccaagtggacctcatcctctccttcagctacaaccaatttttg
ccctttaaggggttgaagcaatcggagaaatactgcagcgttcagggcctgcccttcccc
cgtgtggagcccagccctgaggaccagcgccagccccgggaatgttacctgttctcagac
cccacctgccccgaggcacccgttctgctgcacttcccgctggtcaatggctccttcagg
gaccactcagcccctggtgtctggcacagccctgctgagctcagggctgggcagatggat
ttcatggggaaatcttccccctacactctgtttagcatgacctacaaagaggaagaattc
aactatctgctccagctctctgactacaacgtgcggaacagccaggacatgatcctgcaa
gccctgaagaccgttctgaaacgcagggctccagaggcacatcatcaggagtgcaggcat
gaggcctctgggggtggtattactgtctccatgatggtgaaattcgggaatgtggaagaa
aactggctctgcctccgaatgctgggagctgtcgctcctccctgtcgtcctcctgtgacc
acagagcactag

DBGET integrated database retrieval system