KEGG   Meriones unguiculatus (Mongolian gerbil): 110555334Help
Entry
110555334         CDS       T05884                                 

Gene name
Cacng5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04260  Cardiac muscle contraction
mun04261  Adrenergic signaling in cardiomyocytes
mun04921  Oxytocin signaling pathway
mun05410  Hypertrophic cardiomyopathy (HCM)
mun05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110555334 (Cacng5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110555334 (Cacng5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110555334 (Cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    110555334 (Cacng5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    110555334 (Cacng5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    110555334 (Cacng5)
   05414 Dilated cardiomyopathy (DCM)
    110555334 (Cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mun04040]
    110555334 (Cacng5)
Ion channels [BR:mun04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110555334 (Cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DHHC Claudin_3
Motif
Other DBs
NCBI-GeneID: 110555334
NCBI-ProteinID: XP_021504175
Position
Unknown
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVLNRTKDAEAYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttgtgggaggaaggccctgaccctgctgagcagtgtctttgctgtctgcggc
ctgggcctgctgggcatcgcggtcagcactgattactggctgtacctggaggagggcatc
atccttccccagaaccagagcacggaggtcaagatgtccctgcactcgggcctctggcgg
gtctgcttccttgctggtgaagagcgaggacgctgtttcaccatagagtatgtgatgccc
atgaactcccagatgacgtcagaatccacagtcaatgtgctaaaaatgatccgctcagcc
accccgttcccactggtcagcctcttcttcatgttcatcggcttcatcctgagcaacatc
gggcacatccgcccccaccggaccatactggcctttgtctccggcatctttttcatcctg
tcgggcctctctcttgtggtgggcctggtgctgtacatctccagcatcaatgacgaggtg
ctcaaccgaaccaaggatgcggaagcctatttcaactacaaatatggatggtcctttgcc
tttgccgccatctccttccttttaacagagagtgctggggtgatgtctgtgtacctgttc
atgaagaggtatactgccgaggacatgtacagacctcacccgggcttctaccggccacgg
ctgagcaactgttccgactactccggccagtttctacatccggacgcctggatccgtggc
cgcagcccctcagacatctccagcgacgcctccctacagatgaacagcaactacccagcc
ttgctcaagtgcccggactacgaccagatgtcatcatcgccctgctga

DBGET integrated database retrieval system