KEGG   Meriones unguiculatus (Mongolian gerbil): 110555976Help
Entry
110555976         CDS       T05884                                 

Gene name
Ttn
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun05410  Hypertrophic cardiomyopathy (HCM)
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    110555976 (Ttn)
   05414 Dilated cardiomyopathy (DCM)
    110555976 (Ttn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110555976 (Ttn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110555976 (Ttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mun04812]
    110555976 (Ttn)
   04147 Exosome [BR:mun04147]
    110555976 (Ttn)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110555976 (Ttn)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110555976 (Ttn)
Membrane trafficking [BR:mun04131]
 Others
  Actin-binding proteins
   Others
    110555976 (Ttn)
Cytoskeleton proteins [BR:mun04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110555976 (Ttn)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110555976 (Ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 Receptor_2B4 Ig_6 C2-set_2 Pkinase C1-set Pkinase_Tyr Ig_4 Adeno_E3_CR1 Izumo-Ig PPAK THB DarA_N Kelch_1
Motif
Other DBs
NCBI-GeneID: 110555976
NCBI-ProteinID: XP_021505160
Position
Unknown
AA seq 32913 aa AA seqDB search
LKVSWYCGDKKIKPSRFFRMTQFEDTYQLEIAEAFPEDEGTYTFVANNAVGQVSSTATLR
LEGELSEEGVEGLGTARGAFSDSEDTDSHSLMARRYARRTASMSSWPECLKPTLTQKLTF
QYAFEGEPAVFRCRLVACPAPEVTWFHNNRPIPTGLRRVIQTESDLHRHSSCLEVKRVQG
RDSGSYRFLAVNSEGSAESSASLHVIQKGQDERYLEFLKRAGQTCENIGSVGERRGERIK
VDLRFTGSPFNKKQDVEQRGMMRTIHFGTTGPVRVGCVYGDEWSESKPDIRGWLHVGESF
LDEETKMKLQRLREARKVFLEKKKFSLLDTSSEISSKTMRSEDFVRDAPFSTEEVKSGFV
WELAGDRDRANNSAERIIQNPHSLPNQIHQNRETPPSVQETGDEDVLQTESTLGQETFPE
ESPPKGDLYESVLVSADMQAREQFEEAVNSIMITESAMFTSGQETHECKSEVLCNAPEKI
SQVLTPYSSEPLDTLVKIKESEDVDSEEATQRAWREEQDSASMKAEELNTEQEEKTRPIE
HYFQRHPQRCPPSFLQGIDTQEVYEGDSCKFVCHFQGYPQPIVTWYNNELPIPRSQGFTT
VTFENYSTLTFPAVQPQHSGSVTCVLFNQYGTVKAMGMLRVRPKPRYDFQHPKVPVWPDY
TDEEEELALVFDQAKSTHPSFSQESQEHLHMLPTHPLKLPSAEAELLSFPVEIQITAATP
TPEQDRERRELPELEPEATSRDQTMHSPKHKFIFSSDITNEPPKILQEMPRNASCREGNS
IMLECLISGEPQPVVTWFHNGAMVKQTPKFEVEEVNCSYRLYINDVNSQDSGRYECVAEN
SSGIAENMLDLTVEPISYREYSRLENVSGIYAQYSKNQQAHIQEGSIRTHFYDDPVRPFA
AQSNTKEYTIREYFQSLETVGQATGKNEVYCTTSDEKVPKSMQGASRPTDISMPHRAEFL
QGQDEGHVRERSQPHQTEDTAYPAGDDFREANIRKEGRDDFGNRGPEWGNTEGHSQSDYV
HSKRTSDAVRGTEGSLYTTCEEALEGEWYYPGKRVKHKVIAFEKLHRAEKGVFEKRRTKK
SFVSSPQKKPDDLEFSLKQKESGSSDLRGNVHPAVEMSSHPEADLSSIVMDLKQLSSQAH
GKLEMEEREQQEEMLPLDRTVVSEKVELEAPVTFDLKQFHSQTESARITVQDLANGLQGE
GSLTTQQPASETANPEDIVFDLKQMYSHIEEPGTVFQGQETESKEEKHNEEDISICQNFQ
YAQEQNTAILKTDHALKPFSEAVDESWVLFQTSSADTGESHVSEKNGSVENGERSFISQL
KRAASEGELLGDHETEEESTLTPAFGVTQGYTRTLDDPRGDVQQADTPHRQLSLSQCLPF
LVTGEQQDPDEQRGETTEASGEEISQEVHVQTESSFSTVEGEKIETCFPEHLPRAEEAQT
AETRGSETSLTQYLLAVGKCEVPEARDTNHKAGLIQSDSVTSMEVEEVTFNTVYEYYKQR
QDSLGRPYSPESDISIDVGSTSSEMSELDQFYSPPSSVEHLESPKPPDSYFKPSVTEQYV
ANSRGETLERYSTPLEENGERYSTPSEGEVPERYSTPSGEPLERYSTPPGEALERYSTPP
GEALERYSTPPGEALERYSTPPGEALERYSTPPGETLERYSTPPGEALERYSTPPGERLE
GDFVPTRGPNQTRNVNMNLSKIEREDSTANEHFHTPTEERSSSYELWRSDSFGTPNEAVE
PKDNEMPPSFLEPLSKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDDRIKMERVG
NVCSLEISNVQKGDGGEYVCHAVNIIGEAKSFAKVDVIPQEERAVALPPPVTHQHIMEFD
LENTNSSRTPSPQEIVLEVELSDKEVQEFEKQVKIVTVPEFTPDHKSVIVSLDILPLNLA
DPSKEARGKEGTDFNIDLEAFEMPPRFITPVCDFRIPENSDAVFKCSVIGIPAPEIRWFK
EYMCIEPDDEKYIISEERGSHCLKIRDVGPSDSATYRCRAVNSVGEAICRGFLTIGESQV
SAVTMRTSKVTLSSQKEELVLRSKYADSFFEFQVVEGPPRFIKEIASILSAEDGFQTCSS
DLGLPNVNETLELLSEPPAYPTQFDSRQEGAAPVFIREIADAEISIEDVAKLSVTVVGSP
KPKIQWFFNGVLLTPSADYKLVFDGDNHSLIILFTKFEDEGEYTCVASNDYGKAACSAYL
KINPKAEMEAAEKKAPEKPEGPCPPYFFRELKPVHCAPGTPAVFEYLVHGEPTPTVSWFK
ENIPLYTSVRYTIIHNPDGSGTFIVNDPQSRDSGLYICKAESEWGESTCAAELLVLPEDT
DATDASCKAESTSGVPGGFLETSARGSSVEAFDAQQEITAFVKDAISEAALIAEERLQLS
SVHDAGSSEMSTGVSIRAQGLQPVAASTPQSTGERPSIAGTGHTQQVREPPPTLHLQTVQ
PEGSLPRGDSLQFEEPEEILPSPSPAAQVSSVTVKPLIPLTAEQEGGHPQPSAAAPAHSA
LSSVAEETLQPEETLVSEADKEQRALLLSQSSDEGHVESLEGPDVVISNVQPEPWVPFQH
TYTEEGKILMANADPLESAGQDAAVRTEESKSLYFPLALEEKQVLLKEEQSENMAVPTSQ
TSKSQKEPEAVKGVKEVQGRDLLSKEASIPGLPEEQRSHLKTQVRRALQAAVAMEQASLF
SEWLRNIDKVEVKAVSCTQEPKRILCTYVITSVTSLPEELTITIEGVDPQMANLKTELKD
AVCSIICEERSILMAEDPRFRKEDKLGVQGAREPFSEAQKVETTIEAQAESKYLVSKEEV
SCLSVESQFKAGDTDEVPKAETLKPAEESGTQKAGTVESQEAEHCPTILKHLVDTISEEG
DTVHLTASIANAKEVNWYFKGTLVPSDTKFKCSQDQNAYTLEIHTVKAEDEGEYVCEASN
DSGKAATSAKLTVGERAAPVIKRRIEPLEVALGHLAKFTCEIQGAPNVRFQWFKAGREIY
ESDKCSIRSSNYISTLEILRTQVVDCGEYTCKASNEYGSASCTAALTVTEAYPPTFLSRP
KPLTTFVGKAAKFLCTVSGTPVIETIWQKDGTALAPSPNCRIVDADNKHSLELSNLTIQD
RGIYSCKASNKFGADLCQAELTIIDKPRFIKELEAVQSAINKKIHLECQVDEDRKVTITW
SKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTCTASNEAGSSSSAAAVTVREPP
SFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRISFVNSEAILDI
TDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFIKALEPADIVRGATALLQCEIAGT
GPFEISWFKDKKQIRSSKKYRLFAQKSSVFLEIASFNSADVGDYECVVANEVGKCGCVAT
HLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPISVMWMKGQEVIKEDGKITMSFSGG
VAVLTIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELVQVTAGDPATLE
YTVSGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGS
SSCETTFTVLDRDIAPLFTKPLRNVDSVVSGTCRLDCKIAGSLPMRVSWFKDGREIAASD
RYQIAFVEGTASLEISRVDMSDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSRDV
LPGSAVCLKSAFQGSAPLTIRWFKGDKELVSGGSCYITKEALESSLELYAVKTSDSGTYT
CKVSNVAGSAECSAALFVKEPATFTEKLELSQLLKKGDATQLACKVTGTPPIKITWFVND
RELRESNKHKMSFVESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCASIVLVKEAPYFTK
EFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLRSGRKYKTFIQDQLASLQILKFVA
ADVGEYQCRVTNEVGSSTCSARVTLREPPAFIKKIESTSSLRGGTAAFQATLKGSLPITV
TWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE
PATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELSLGPKYKISVTDTVSILK
IISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLRKMDSIKGSFIDLECI
VAGSHPISIQWFKDDQEISASDKYKFSFHDNTAFLEISQLEGTDSGMYTCSATNKAGHSQ
CSGHLTVKEPPYFIEKPQSQDVNPSTRVQLKALVGGTVPMTIKWFKDNKELHPGAARSVW
KDDTSTILELFSAKAADSGTYICQLSNDVGTASSKATIFVKEPPQFIKKPSPGLVLRNGQ
SATFECQVTGTAEIRVSWYLDGNEITDARKYGISFVDGLATLQISNARVENSGTYVCEAR
NDAGTASCSIELKVKEPPSFIRELEPAEVVKDSDVELECEVMGTTPFEVTWLKNNREIRS
GKKYTMSEKMSVFYLHITKCDPSDVGDYQCVIANEGGSCSCTARVALKEPPSFIKKIENV
TTVLKSSATFQSTVAGSPPISVTWLKDDQILEESDNVHISFVDGVATLQVRSVDDGHSGR
YTCQAKNESGVERCHAFLLVQEPAQIIEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKD
GKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQDIPP
SFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCRENTVSLEVS
NLELEDTANYTCKVSNVAGDDACSAILTVKEPPSFLVKPERQQAIPDATVEFKAVLKGTP
PFKIKWLKDQVELTSGPKCFIGLEGSASFLNLYSVDASKTGQYTCQVTNDVGSDSCTTVL
LVTEPPKFVKKLEASKIVKAGDSARLECKITGSPEIQVVWYRNEHELAASDKYQMTFIDS
MAVLQMNSLGTDDTGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPVVETLKNTEVSLE
CELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHASIHILNVESTDIGEYHCKAQNEVGS
DTCVCAIKLKEPPKFTSKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENI
RISFVNNTATLQFAKAEPANAGKYICQVKNDGGVRESMATVTVLEPAVIVEKAGSVTVTV
GETCALECKVAGTPELFVEWYKDGKLLTSSQKHKFSFYNKISSLKVLSVEKEDAGTYTFQ
VQNNVGKSSCTATVDVSDRMVPPSFTRRLKDTGGVLGSSCVLECKVAGSSPISIAWFHEK
TKIVSGAKYQAAFSDNVCTLQLNSLDASDTGSYTCVAANVAGSDECRALLTVQEPPSFVK
EPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGDRCSVYFEDTVAELELFNVDV
SQSGEYACVVSNDAGRASCTTRLFVKEPASFVKRLSDHSVEPGKSVILEGTYTGTLPISV
TWRKDGVSVAPSERCSIVTTEKTCILEILSSTKGDAGRYSCEIENEAGRDACEALVSMLE
PPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLV
FNKVSINDSGEYTCVAENSIGTAASKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCR
LNGSAPIQVSWYRDGVLLRDDENLQMSFADNVATLKILQTDLSHSGQYSCSASNPLGTAS
STARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNY
TITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLDPSKVAK
QGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFANSVALLTINEACAEDSGDYIC
EAHNGVGDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCELSGTPPFEVVWVKDRKQ
VRSSKKFKVTSKNVDTSLHIFNLEAPDVGEYHCKATNEVGSDTCVCTVKFKEPPRFVKKL
SDASTLIGEPVELQAVVEGFQPISVVWLKDKGEVIRESENIRISFVDNIATLQLGSPEAS
HSGKYVCQIKNEAGMRECSAVLTVLEPARIVEKPEPMTVTTGNPLALECVVAGTPELSAK
WFKDGRELSAGGRHQITFVRNLASLKIPSAEMNDKGLYSFEVKNSVGKSSCTVSVHVSDR
IVPPSFIRKLKDTSATLGASLVLECRVSGSAPISVGWFLDGSEIASSPKCQPSFSDNVCT
LKLSSLEPSDTGTYTCVAANVAGQDESSAVLTVQEPPSFEQTPESVEVLPGTSLTFTCVI
RGTPPFKVKWFKGSRELASGEACTISLEDFVTQLELLEVEPLQSGDYSCLVTNDAGSASC
TTHLFVKEPATFVKRLADTSVETGSPIVLEATYTGTPPISVSWMKNEYPLSQSPNCGITT
TEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPLEHVEAAIGEPT
TLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFRNNLASLVINKVDHSDVGEYTCKAENS
VGAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLK
DDSNLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLLLSEHEVPPFFDLK
PVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKG
DAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLDPTRIVKQEESTRYECKIGGSPEIKV
LWYKDEVEIQESSKFRMSFEDSVAVLEMHGLSVEDSGDYTCEARNAAGSASSSTSLKVKE
PPTFRKKPFPVETLRGADVHLECELRGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIH
ILSVDAADVGEYQCKATNDVGSDACVGSVTLKAPPQFVKKLSDISTIIGKEVQLQATVEG
AEPISVAWFKDKGEIVRESDNVWISYSENVATLQFSRAEPANAGKYTCQVTNDAGAQECS
GTLSVLEPAAVVEKPENIKVTAGDTCTLECTVSGTPELSTKWFKDGRELSSDSKYKISFF
NKVSGLKIIGAAPGDSGVYSFEVQNPVGKDSCTVSVQVSDRIIPPSFTRKLKETNGLSGS
SIVMECKVHGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEDSDAGDYTCIAT
NVAGSDECSAPLTVREPPSFVQKPDSMDVLTGGNVTFTSIVKGTPPFSISWFKGSSELVP
GARCSVSLQDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTAHLFVKAPAIFVKRLNDY
SIEKGKPLILEGTFSGTPPISVTWKKNGINVAASQRCNITTTEKSAILEILSSAVEDSGQ
YNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVTVGDSASLQCQLAGTPEIGVSWYKG
DTKLRPTATCKMHFKNNVATLVFTQVDSNDGGEYICRAENSVGEVSSSTFLTVQEQKLPP
SFSRQLRDVQETVGLPVVFECAIRGSEPISVTWYKDGKPLKDSPNVQTSFLDNVATLNIF
KTDRNLAGQYSCTATNPIGSASSSAKLILTEGKNPPFFDIPLAPVDAVVGESADLECHVT
GTQPIKVSWAKDNRELRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAMNEVGKDSCT
AQLNIKERLIPPSFTKKLSETVEETEGNSFRLEGRVAGSQPITVAWYKNNVEIHPTSNCE
ITFKNNTLLLQVKRASMADAGLYTCKATNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTV
SEGDFVQLSCHVQGSEPIRIQWLKAGREIKPSERCSFSFASGTAVLELKETAKADAGDYV
CKASNVAGSDSSKCKVTIKEKPAAAPAAKKAAVDGKLFFVSEPQSIRVVEKTTATFIAKV
GGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIE
SNVNLQVDERKKQEKIEGDLRAMLKKTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARM
YGITDFRGLLQAFELLKQSQQEETHRLEIEELEKSERDEKEFEELVSFIQQRLTQTEPVT
LIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKYEIRIDGDRHTLRVK
NCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEW
FRNGRILKPQGRVKTEVEHKVHKLTIADVRAEDQGRYTCKHEGLETSAELRIEAEPIQFT
KRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTP
DDEGVYSVIARLEPRGEARSTAELYLTTKEIKLEMKPPDIPDSRVPIPTMPIRAVPPEEI
PPAVAPGIPLLLPLPEEKKPPGKRVEVTKKAVKKDTKKVVAKPKEEAPPPPVAKKPPPPT
PMIPAKTSEIIDVSSKAEEVKITTITRKKEIHKEKEAVYEKEQAVYEKRVLIEPWEEPYE
ELETEPYTEYEEPYYEEPDEDYEEVQVEAKKEIHEEWEEDFEEGQEYYEREEGYDEGEEE
WEETYQEREVIQVQKEVHEELHERKTPAKVPEKKAPPPKVVKKPVVEKIEKTSRRMEEER
VQVTKVPEVSKKIVPQKPFRTPVQEEIIEVKVPAVHTKKMVISEEKMFFASHTEEEVTVT
VPEVQKKTVTEEKVHVAVSKKIEPPPKVPEPPKKPIPEEVVPVPVPKKVEPPVPKVPEAP
KKPVPEEKKPVPLPKKKEPAAPPKVPEAPKKPAPEEKIPVPVTKKEAPPAKVPEVQKKVV
TEEKITIITHREESPPPAVPEIPKKKVPEERRPVPQKEEAPPPKVPAPKKAVPEEIAPAP
IPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRVEVMRHEASAEEEWAYSEEEERVSV
SVYREEEREEEEAEITEYEVMEEPEEYVVEEKMHFISKKVEVEPAKVPEKREKKIIPKPK
VPAKIEEPPPAKVPEPPKKIVPEKKVPAPAAKKEKVPPAKAPEEPRKPVPERRVPAEVVE
IEEPLPTKVTERHMKVTQEEKILVAVTKKEEPPRARVPEEPKKVVPEEKFPKLKPRREAE
PPAKVTEVRKRAVKEEKVSIEVPKRELRPTKEVTVTEEKKWAYTREEETISEHREEEYED
YEDYEEYKEYEEYEPTDEYDQYDEYAEREQYEEHEEHEEYAPEPKKPIPAKPTQEPVPAK
PKAPPPKVLKKAVPEEKPPLLIQKKLKPLPPKAPEEPKKVVEEKIQISITKREKQQVTEP
AAKVPTKPKRVVPEAKVPAPKAEVPAPRRVPGVPKKREVEEVVSFKEEVETHGEEYIVEE
EEELVHEEYVHEEEYVHEEEYEAVVPVKVPEVPKKPVPEEKKPVPVPKKKELPPAKAPEI
PKKPEEKVAVPIPKKEKAPPAKVPEVPKKPVPEEKAPAPVPKKVETPPAKVPEVPKKPVP
EKKVPVPAPKKAEAPPAKVPEAPKKLIPEEKKPTPVLKKMEAPPPKVPKKREVVSVPVAL
PQEEEAPFKEVIVPEEELPPEEEEVLPEEEEVLPEEEEVPAEEEALPEEEEVPPEEEEAL
PEIKPKVPRPAPVPEIKKKVPEKKIVVPKKEEAPPTKVPEVPKKVEERRIIPPKEEEVPP
AEVYEEAEEPTPEEIPEETPSIEEEEVVVEEEEEEVVVLPKAPEVVKKAVPAAPTPVPKK
VEPPPTKVPKKIPEEKVPVPVPKKEAPPAKVPEVPKKEVPEKKVPVPKKEVVPPAKGKAV
FEEKISVSYQQEEIVQERRELELVEAEVEEAFEEEEFHEVQEYFEEEEFHEVQEFIRVEG
RRFQEEHKAEQIHRVIEFLEAEEVEVYEKPKIPPKKGPEVSEKVIPPKKPPTKVVPRKEP
PAKVPEVTKKTVVEEKVRVPEEPKAPPPKAPEVPKKIAPEEKVREAVPKKPEVPPPKVPE
EPTEVIPEKKVSVVPPKKPKAPPVTVPEAPREAVPEKEVSMVPPKKPEAPPAKVPEAPQE
VIPEKKVPVAPKKKPEAPPVKVPEAPQEVIPEKKVPVAPKKKPEAXXXKVPEVPKAAVPQ
KKTPEAISPKAESPPPEVYEEPAEEIAPEEPPEEAVEEPMPAPPPKVSAPPKKPVPEKKV
PPAVAKKPEPPPAVKVPEVPKEAVPEKKVPPAVPKKPEAPPAKVPEVPKVVVPEKKVAVP
KKPEVAPAKVPEVPKKPVIEEKPAIPVPKKVESPPPEVYEEPEEVVAEEEEPVPVVEEEE
YEAPPLPAPVPEEPKKVVPEKKFPVIKKPEALPPKEPEPEKKVIEKPKLKPRPPAPVPSP
PKEDVKEKIFQLKAVSKKKVPEKPEVVEKVEPAPLKVPTAEKKVRKLLPEPKPQPKEEVV
LKSVLRKRPEEEEPKVEPKKVEKVKKPEEPQPPPKAVEAEAPPEPKPKERKVPEPSKVPE
IKPAIPLPGPEPKPKPEPEVKTMKAPPIEPTPTPIAAPVTVPVVGKKAEAKPKDEAAKPK
GPIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTEAE
SVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC
VLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKI
VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEIIREWLVK
PIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPMEPNDKTEILKEGNHLILKVKNAM
PEDIDEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTVYEKESASFDAEISEEDIPGEWK
LKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQACNAVTTAILTVKEIELDFAV
PLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHMLVINDSQFDD
EGVYTAEVEGKKTSAQLFVTGIRLKFISPLEDQTVKEGETATFVCELSHEKMHVVWFKND
VKLHTTRTVLMSSEGKTYKLEMREVTLDDISQIRAQVKNLSSTANLKVLEADPYFTVKLH
DKTGVEKDEIILKCEVSKDVPVRWFKDGEEIVPSPKHSVKTDGLRRILKIKKAELKDKGE
YVCDCGTDTTKANVTVEARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPL
TASPDCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKELPLIFITPLSDVK
VFEKDEAKFECEVSREPKTFRWLKGTQELAGDDRFELIKDGTRHALVIKSAAFEDEAKYM
FEAEDKRTSAKLIIEGIRLKFLTPLKDVTAKEREDAVFTVELSHDNIPVSWFKNDQRLHT
SKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLEGDPYFTGKLQDYTGV
EKDEVVLQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD
CGTDQTSGKLDIEDREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQTP
ECEIKEEGKIHVLILHNCQLDQTGGVDFQAANVKTSAHLRVKPRVIGLLRPLKDVTVTAG
ETATFDCELSYEDIPVEWYLKGKKLEPNEKVVTRSEGRVHTLTLRDVKLEDAGEVQLTAK
DFKTQANLFVKEPPVEFTKPLEDQTVEEEATAILECEVSRENAKVKWFKNGTEILKSKKY
EVVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVKEKET
ARFECEISKENAKVQWFKDGAEIKKGKKYDIISKGAVRILVVNKCLLNDEAEYSCEVRTA
RTSGMLTVLEEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYKGDEEIIETGRFEI
LTDGRKRILVIQNAQLEDAGSYNCRLPSSRTDSKVKVHELAAEFISKPQNLEILEGEKAE
FVCTISKESFEVQWKRDDQTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARA
AAHLTVIEKLKIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKWFRNDEAIFDSSKYIILQK
DLVYTLRIRDARLDDQANYSVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIETMEKKS
VTFWCKVNRLNVTLKWTKNGEEVAFDNRVSYRIDKYKHSLIIKDCGFPDEGEYIVTAGQD
QSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF
EKDGSIHRLIIKDCRLEDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVI
FLAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEA
RAKLELAAAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKENEPLSTKTVDTTAE
QTSFRIVEAKKEDKGRYKIVLQNKHGKAEGFINLQVIDVPGPVRNLEVTETFDGEVGLAW
EEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRV
GTGEPVETDSPVEARSKYDVPGPPLNVAITDVNRFGVSLTWEPPEYDGGAEVTNYVIELR
DKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIE
RPSPPVNLSASDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKPVPELT
YKVTGLKKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPN
PIKILVPSTGYPRPKATWTFGDQVLEEGERVKIKTISAYAELVISPSERTDKGIYTLTLE
NPVKSISGEIDVNVIAPPSAPKELKYSDVTKDSVHLTWEPPDDDGGSPLTGYVVEKRDMS
RKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGAPAYIDEPVNMSAPATVPDP
PENVKWRDRTAQSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDRWVACGEPVADTKMEVTG
LEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIEL
PATVTGKPEPKVTWTKADTILKPDQRITIENIPKKSTVTITDSKRSDTGTYIVEAANVCG
RVTAVVEVNVLDKPGPPAAFDITDITNESCLLTWNPPRDDGGSKVTNYVVERRATDSDVW
HKLSSTVKDTNFKATKLTPNKEYVFRVAAENMYGVGEPVQAAPIVAKYQFDPPGPPTRLE
PSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNK
KKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGKTSLVLNWTKPEHD
GGAKIESYVIEMLKTGTDDWVRVAEGVPTTEHLLTGLMEGQEYSFRVRAVNKAGESEPSE
PSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW
QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIGDSVLAKDTFTTPGPPYAL
TVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTSGPDCNFRVTDVIE
GTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEK
TGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAVGVSE
PSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKAS
DRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASE
ITKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLAWTVKDLIPNGEYF
FRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAKAMTITWKPPLYDGGSK
IMGYIIEKLVKGEDRWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGIGEPSRATP
PAKAVDPVDAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDDNVIIPEEIKKRAA
PPVRRKKGEAEEEEPFFLPLTERLSINNSKQGESQLRVRDSLRPDHGQYMIKVENDHGVA
KAPCTVSVLDTPGPPINFVFEDIRKNSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEW
IVITATLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAKDPFEPPDAPDKPI
VEDVTSNSMLVTWNEPKDNGSPILGYWLEKREVNSTHWSRVNKTLLSSLKTKVDGLLEGL
TYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPVPRVADTSSTTIELEWEPPAFNGG
GEIIGYFVDKQLVGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVSAVNAAGEGPPGET
EPVTVAEPQEPPNVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGELDKERV
VIENVGTKSELIIKNALRKDHGRYVITATNSCGTKFAAVRVEVFDVPGPVLDLKPVVTNR
KMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETDRSKCDITGLIEGQEYKFRVI
AKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSDGGSPVQGYI
IEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDIGESEPSLPLNVVIQD
DEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEKVIEKPTDALQITK
EEVSRSEAKTELSIPKAVREDKGTYTITASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK
AESCYLTWDAPLDNGGSEITHYVIDKRDASRKKSEWEEVTNTAVERRYGIWKLIPNGQYE
FRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLVSWTPPLDNGGSPI
TGYWLEKREEGGAYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPS
EPSDPAVAGDPIYPPGAPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTD
WKRVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEVPEV
FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETA
ENSSVIIIPECIRAHSGKYSITAKNKAGQKTANCRVKVMDAPGPPKDLKVSDITRGSCRL
SWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLISEQQYFFRVRAENR
FGIGPPAETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVEC
LAWDPTGKKKEAWRQCNKRDVEELEFTVEDLVEGGEYEFRVKAVNEAGVSKPSATVGPVT
VKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDSKEPVVYDAHV
NKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESIS
ADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYTIPKLLEGHEYVFR
IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG
YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS
DPVTARDPVAPPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKVTGYIVEYKEEGKDEWEKG
KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGAGEPGEVTDVIEMKDRIVVPDLQLDASV
RDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAISSSMVIKNCQRSHQ
GVYSLLAKNEGGERKKTIIVDVLDVPGPVGIPFLSDNLTNDSCKLTWFSPEDDGGSPITN
YVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIGMGPFVETPNALVI
RDPITVPERPEDLEVKEVTKSTVSLTWNPPKYDGGSEIINYVLESRLIGTEKFHRVTNDN
LMSRKYTVKDLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKLTV
RVGEAFALTGRYSGKPKPKVDWFKDEVDILEDDRTHIKTTLTTLALEKTKAKRSDSGKYC
VVVENSTGSRKGFCQVNVVDRPGPPVGPVTFDEVTKEYMIISWKPPLDDGGSEITNYIIE
KKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFR
VPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRWVRVTKEPIHPYTK
FRVPDLLEGCQYEFRVSAENEIGVGEPSPPSKPVFARDPIAKPSPPINPEAIDTTCNSVD
LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQSYKFRVL
AVNEAGESDPAQVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAIIKGVPFPKV
TWKKGDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP
GPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERKDVAAAQWSPLSTTSKKKSHMA
KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVW
NKPDRDGGSPITGYLVEYQEEGAQDWIKFKTVKNLECVVTGLQQGKTYRFRVKAENIIGL
GLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIVRGVPVPTAKWAADGTE
ISTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVHLTVLDVPGPPTGP
INILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAGSSKLKLKVPHLQK
GCEYVFRVKAENKMGVGPPLDSIPTVAKHKFNPPSPPGKPVVTDITENAATVSWTLPKSD
GGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSP
SSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILGYVVECQKPGTAQW
DRINKDDLIRQCAVRVPGLIEGNEYRFRIRAANTVGEGEPRELAESVIAKDILHPPEVEL
DVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLGKDKRVDLIRDLPRVELQIKE
AVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGG
SEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKT
PILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWERV
HKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVRTEEVVVKEDLQKPVLDLKLSGV
LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDAADLTKSPRVKIDTSAESSKFSLTKARRSD
GGKYVVTATNTAGSFVAYATVIVLDKPGPVRNLKITDVSSDRCTLRWDPPEDDGGCEIQN
YILEKCESKRMVWSTYSANVLTPGATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAK
TKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLERKEKHAVRWVPVNKSAI
PERRMKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTSK
HSITLAWGKPVYDGGAPIIGYVVEMRPKKADASPDEGWKRCNAAAQLVRMEFTVTSLDEN
QEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVVVRAGCPIRLFAIV
RGRPAPKVTWRKVGIDNVVRRGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVF
VNVKVLDTPGPVSDLKVSDVTKTSCHVSWGPPENDGGSQVTHYIVEKREAERKTWSTVTP
EVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLSEPDPPRKLEVTEM
TKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLSLVVTGLKEGKKYK
FRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRVEAHVYGKPNPIC
KWKKGDDDVVTSSHLAIHKGDNSSVLIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIVMD
APGPPQPPFDIADIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS
CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKNARVTKVNKDCIFV
KWDRPDSDGGSPITGYLIERKERNSLLWVKANDTVVRSTEYPCAGLVEGLEYSFRIYALN
KAGSSPPSKPTEYVTARMPVDPPGKPEVVDVTKNTASLIWARPKHDGGSKIIGYFVEACK
LPGDKWVRCNTTPHQVPLEEYTATGLEENAQYQFRAIAKTAVNISQPSEPSDPVTILAEN
VPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTPIKPAEGIKMAMKRNL
CTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYADRAMLSWE
PPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGV
GDPIFTEPAIAKNPYDPPGRPDPPVISNVTKDHMTVSWKAPADDGGSPITGYLVEKRETQ
AVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYPPG
PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVRCNLPEKLQKTRFE
VTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDAELRKTLILRAGVT
MRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYVLTLEN
SCGRKEYTIVVKVLDTPGPPVNVKVKEVSKDSAYITWDPPVIDGGSPIINYVVEKRDAER
KSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVVDL
KALAVTKSSCTIGWKKPRTDGGSRITGYVVDFLTEENKWQRVMKSLSLQYSTKDLKEGKE
YTFRVSAENENGEGTPSEVSVVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKGKP
APSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTLSI
KVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRDSVNNKWVTCASAV
QKTTFRVTRLHEGVEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVRHD
SVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRV
MAINLAGVGKPSLPSEPVVALDPIDPPGKPEVISVTRNSVTLIWTEPKYDGGHKLTGYIV
EKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICK
DEYEAPTIVLDPTIKDGLTVKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIAQITS
TPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPGPIEISNVSAEKAT
LTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLIQGNEYLFRVSAVN
HYGKGEPVQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHIER
REKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNLVLMKDAA
YPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDDAWIKDTTGTALRI
TQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNIEIVEKEMAPDFELDAELRRTLVVRA
GLSIRIFVPIKGRPAPEVTWTKDNVNLKHRANIENTESFTLLIIPECNRYDTGKFVMTIE
NPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREAT
RKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTEPVRASEAPLPPDS
LNIMDITKSTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHISTVKGLEYVVKNLTEG
EEYTFQVMAVNSAGRSAPRESRPVIVREQTMLPELDLRGIYQKLVIARAGDNIKVEIPVL
GRPKPTVTWRKGDQVLRQTQRVNVENTAASTTLNISECVRSDSGPYPLTARNTVGEVGEV
ITVQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVEMRQTDSTTWAELA
TTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASIVANYPFKVPGPPGTPQVTAV
TKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNIFKSTGLTDGIAYE
FRVIAENMAGKSKPSKPSEPTFALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITS
YVVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAI
TCRDDLEAPRIMVDVKFKDTITLKAGEAFKLEADVSGRPPPTMEWTKDSKELEGTGKLEI
KIADFSTHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSDVTSE
KCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVTKLLKGNEYIFRVM
AVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYI
VERRDKAGQRWVKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGMSAPSATSPFYKAC
DTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQVVTPPAG
LKATSYTITNLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLPPEIELDADLRKVV
IIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYI
LTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEK
RESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPL
PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEATITG
LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKIDVP
FIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGEAT
ETLNVIVLDKPGPPTGPVKIDEVTADSVTLSWEPPKYDGGSSINNYIVEKRDTSTTTWQI
VSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVIAQYPFKVPGPPGTPFVT
LASKDSMEVQWHEPVSDGGSRVVGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGIE
YEFRVSAENIVGIGKPSKPSECYVARDPCDPPGRPEAIVVTRNSVTLQWKKPTYDGGSKI
TGYVVEKKELPDGRWMKASFTNIIDTQFEVSGLIEDHRYEFRVIARNAAGVFSEPSESTG
AITARDEVEPPKISMDPKYKDTVVIHAGESFRVDADIYGKPIPTTQWVKGDQELSSTARL
EIKSTDFATSLSVKDAVRVDSGSYILKAKNVAGERSVTINVKVLDRPGPPEGPVAISGVT
AEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCKVMKLLEGNEYIFR
IMAVNKYGVGEPLESEPLIAKNPFVVPDAPKAPEITAVTKDSMIVVWERPASDGGSEILG
YVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQK
ACDPIYKPGPPNNPKVMDVTRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPP
TGINKTNLEVEKLLEKHEYNFRVCAINKAGVGEHADVPGPVKVEEKLEAPDVDLDLELRK
VINIRAGGSLRLFVPIKGRPTPEVKWGKADGEIRDAAIIDVTSSFTSLVLDNVNRYDSGK
YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKATEITKDSVSITWEPPLLDGGSKIKNYIV
EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPARTADPIKVAEV
PQPPGKITVDDVTRNSVSLSWTKPEHDGGSKVIQYIVEMQAKNTDRWSECARVKSLEAVI
TNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPSFSSYSIQVGQDLKIE
VPISGRPKPTISWTKDGVPLKQTTRVNVTDSLDLTTLSIKEAHKDDGGQYGITVANVVGQ
KTAAIEIITLDKPDPPKGPVKFDEVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW
DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPIVAQYPYKEPGPPGTPF
ATAISKDSMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKALNLEEG
IEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAVIVKRNEITLQWTKPVYDGGS
MITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS
TGPVTAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA
RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTG
VTSEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYI
FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEI
IGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEEHEYEFRVSAENAAGVGEPSPATIY
YKACDPVFKPGPPTNAHIVDTTKNSITLAWSKPIYDGGSEILGYVVEICRADEEEWQIVT
PQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEAAAVPGTVKPEDKLEAPELDLDSEL
RKGIVVRAGGSARIHIPFKGRPTPEITWSKEEGEFTDKVQIEKGVNFTQLSIDNCDRNDA
GKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNY
VIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETSDAVKAS
EPPSPPGKVALTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVCNA
VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSFKLPFNTYSVQAGEDLK
IEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKDDFGKYSVTATNSA
GTATENLSIIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTT
NWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSAPLDSKPVLVQYPFKEPGPPGT
PFVTSVSKDQMLVQWHEPVSDGGSKVTGYHLEQKEKNSILWVKLNKTPIQDTKFKTVGLD
EGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIVITRNSVTLKWKKPAYDG
GSKITGYIVEKKDLPEGRWMKASFTNVVETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS
ESSGAITARDEIDAPNASLDPKYRDVIVVHAGETFVLEADIRGKPIPDIVWSKDGNELEE
TAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPEGPLR
VTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGN
EYIFRVMAVNKYGIGEPLESEPVIACNPYKLPGPPSTPEASAITKDSMVLTWTRPVDDGG
AEIEGYVLEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEP
SVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIEFKEAAADEWT
TCTPPSGLQGKQFTVTQLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELD
ADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAEGVLTERAQIEVTSSYTMLVIDNVTR
FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVTLAWEPPLIDGGAKI
TNYIVEKRETTRKAYATITNNCTKSAFKIENLQEGCSYYFRVLAANEYGIGLPAETAEPV
KVSEPPLPPGRVTLVDVTRSTATLKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKT
LEATVSGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSVELPFSTFNVKAND
QLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVSSSKTVTTLSIKEASREDVGTYELCVS
NTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGCQISNYIVEKRETT
STTWQVVSQAVARTSIKIVRLVTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPP
GTPKVVHATKSTMVVSWQIPVNDGGSQVLGYHLEYKERSSILWSKANKVLIADTQMKVSG
LDEGLMYEYRVYAENIAGIGKCSKACEPVAARDPCDPPGQPEVTNITRKSVSLKWSKPRY
DGGAKITGYTVERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFARNAADSVSE
PSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEI
EERAKTEIVSTDSNTTLTVKDCVRRDSGQYVLTLKNVAGTRTMAVNCKVLDKPGPPAGPL
EINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAELRTTSCKVTKLLKG
NEYIFRVTGVNKYGVGEPLESVAVRALDPFTIPSPPTSLEITSVTKDSMTLCWSRPETDG
GSDISGYVIERREKNSLRWIRVNKKPVYDLRVKSTGLREGCEYEYRVFAENAAGLSLPSE
TSPLVRAEDPVFLPSPPSKPKIVDSGKTTITISWVKPLFDGGAPITGYTVEYKKSDETDW
RAAIQSFRGTEYTMSGLTTGAEYVFRVRSVNKVGASDPSDSSDPQVAKEREEEPVFDVDS
EMRKTLIVKAGSSFTMTVPFRGRPVPNVSWSKPDTDLRTRAYIDSTDSRTLLTIENANRT
DSGKYTLTIQNVLSAASMTFVVKVLDSPGPPSNITVREVTKETAVLSWDVPENDGGAPVK
NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVAGENEFGVGVPAETKEGVK
ITEKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRVVHYVVEALEKGQKNWVKCAVVKTT
HHVVSGLRENHEYFFRVSAENQAGLSDPRELLLPVLIKDHLEPPEIDMKNFPSHTVYVRA
GSNLKVDIPISGKPLPKVTLSRDGVPVKATMRFNTEITAENLTINLKESVTADAGKYEIT
AANASGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYDGGSHVTNYIVLKR
ETSTAVWTEVSVTVARTMIKVMKLTTGEEYQFRIKAENRFGISDHIDSACVVVKLPYTTP
GPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQKANKMIIRTTHFK
VTTISAGLIYEFRVYAENTAGIGKPSHPSEPVLAIDACEPPRNVRITDISKNSVNLSWQQ
PAFDGGSKITGYVVERRDLPDGRWTKASFTNVIETQFTVSGLTQNSQYEFRVFARNAVGS
VSNPSEVIGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWYKDD
KELQTNALVCVENSTDLASILIKDANRLNSGSYELKLRNAMGSASATIRVQILDKPGPPG
GPIEFRTVTAEKITLLWRPPADDGGAKITHYIVERRETSRVVWSMVAENLEECIITTTKI
IKGNEYIFRVRAVNKYGTGEPLESDPVVAKNAFVTPGPPSIPEVTKTNKNSMTVVWDRPT
VDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGMGP
FSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMRQGEE
EEWTIVSTKGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMTEPVQAKDILEEPE
IDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKEDKNLGSDARYSIQNTDSSSLLV
IPQVTRHDTGKYVLTIENGVGQPKSSTVTVKVLDTPAACQKLQLKHVSLGTVTLLWDPPL
IDGGSPVINYVIEKRDATKRTWSVVSHKCSSTAFKVTDLSEKTPFFFRVLAENEIGVGEP
CETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDYVVERKGKGEQAWS
HAGISKTCEIEIGQLKEQSVLEFRVMARNEKGQSDPVTIGPLTVKELVITPEVDLSEIPG
AQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNVKKEH
GGKYSVILDNAICRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMSWDVPEDDGGGEIT
CYSIEKREASQTNWKMVCSSVARTTFKVSSLVKDSEYQFRVRAENRYGVSEPLVSNIIMA
KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQRVNTSP
ISGREYRATGLIEGLDYQFRVYAENSAGLSKPSDASKFTLAVSPVDPPGTPDYIDVTRET
ITLKWNPPLRDGGSKIVAYSIEKRQGNDRWVRCNFTDVSECQYTVTGLSPGDRYEFRILA
RNAVGTISPPSQSSGIIMTRDENVPPTVEFGPEYFDGLVIKSGDSLRIKALVQGRPVPRV
TWFKDGVEIERRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGSTKAEITVKVQD
TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEAHS
YTAIKLITGNEYQFRVSAVNKFGVGRPLESDPVVAQIQYTIPDAPGIPEPSNVTGNSITL
TWARPESDGGNEIRHYILERREKKSTRWVKVTSKRPISETRFKVTGLVEGNEYEFHVMAE
NAAGVGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGLEIIGYVI
EMCKADLGDWHKVNTEPCVKTRYTVTDLQAGEEYKFRVSAVNAAGKGDSCEVTGTIKAVD
RLSAPELDIDANFKQTHIVRAGASIRLFIAYQGRPTPTAAWSKPDSNLSIRADIHTTDSF
STLTVENCNRTDAGKYTLTVENNSGSKSITFTVKVLDSPGPPGPITFKDVTRGSATLMWD
APLLDGGARIHHYVVEKREASRRSWQVVSEKCTRQILKVGDLTEGVPYYFRVSAENEYGV
GEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITSYLLEMRQKGSD
FWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLT
GITNQLITCKAGSAFTIDVPISGRPAPKVTWKLEEMRLKETDRMSITTTKDRTTLTVKDS
MRGDSGRYFLTLENTAGVKTFTVTVVVIGRPGPVTGPIEVSSVSAESCVLSWTEPKDDGG
TEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSSENRFGVSKPVETV
PIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWVEKKERNTILWVKE
NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDPPGRPEVTDV
TRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSENSFTVTALSEGD
TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAA
VGGKPEPKIIWTKGDRELDLCEKVSLQYTGKRATAVIKYCDRGDSGKYTLTVRNASGTKS
VAVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIV
EGECLTLSYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPVVARNSFTIPSQPGIPEEVG
AGKEHIIIQWTKPESEGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTGLMEGCD
YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSTPRVVDTTKRSISLAWTKPMYDGG
ADIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVTDLKMGQKYSFRVAAVNVKGMSEYSE
AVAGIEPVERLEIPDLELADDLKKTVTLRAGASLRLMVSVSGRPAPVITWSKKGIDLANR
AIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVS
RDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFR
VLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV
LEACKAGTERWMKVVTLKPTILEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVTVQ
DLRVLPTIDLSTMPQKTIHVPAGRPIELVIPIAGRPPPTASWFFAGSKLRESERVTVETH
TKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSVT
VSWEAPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLTEGNEYVFRVAATN
RFGIGSYLQSEVIECRSSTSIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVER
KEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRITAINARGTGKPSRPSKPIVAMDPI
APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQREWTKCNTTPTKIR
EYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGVFVRQ
GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRDDSGTYDLVLE
NKCGKKTVYIKVKVIGSPNAPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREV
PKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPE
PPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYT
VTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQ
WEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQLTVGGLLEATEYEFRVFAENE
TGLSRPRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEVAQLSCQIVGRPLPDIKWYRFG
KELIQSRKYKMSSDGRTHTLAVMTEEQEDEGVYTCVATNEVGEVETSSKLLLQAAPQFHP
GYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN
VQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPADD
GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISEPL
EVASIVIIKSPFEKPSVPGRPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNK
WIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEVSEPVTPKSDVPIQAPHF
KEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA
SVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIP
FSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGID
QKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYIVEKCATTAERWLR
VGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKEDKTRALNYDEEVDE
AREVTKTKASHSKTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTFMAKFVKVKGTDQV
LVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVS
YVRQVCEALEFLHSQNIGHFDIRPENIIYQTRKSSVIKIIEFGQARQLKPGDNFRLLFSA
PEYYGPEVHQHDVVSSATDMWSLGTLVYVLLSGINPFLAETNQQMIENIMNAEYTFDEEA
FKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQRLERVSTKVIRTLRHRRYYHTLI
KKDLNMVVSAARVSCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAVGEEGGYVKYVCK
IENYDQSTQVTWYFGVRQLENSEKYEIAYEDGVATMYVKDITKFDDGTYRCKVVNDYGED
SSYAELFVKGVREVSDYYCRRTKRVKRRTDAMRLLERPPEFTLPLYNKTAYVGENVRFGV
TITVHPEPRVTWYKSGQKIKPGDDEKKYTFQSDKGLYQLTINSVTADDDAEYTVVARNKY
GEDSCKAKLTVTLHPPPTDTMLRPMFKRLLANAECHEGQSVCFEIRVSGIPAPTLKWEKD
GQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYV
KQEFQSKEERERHVQKQIDKTLRMAEILSGTETVPLTAVAQEALREAAILYKPAVSTKTV
KGEYRLQTEEKKEERKLRMPYEVPEPRRRTQAAVEEDQRIKQFVPMSDMKWYKKIRDQYE
MPGKLDPVVQKRPKRIRLSRWEQFYVMPLPRLTDQYRPKWRIPRLSQDDLEMVRPARRRS
PSPDYDLYYYRRRRRSLGDMSDEELLLPIDDYLALKRTEEERLRLEEELELGFSASPPSR
SPPRFELSSLRPASPAAAEEERRRDLRYSAYHIPAREETSASYAELRERHARAAYRQPRL
RQRILAEREDEELLRPAATAQRLSEYRSELEHLSKEERSKKTSTRQRRVTEITEIEEEYE
LSRRAHRESSASVSRLLRRRRSLSPTYIELMRPVSELIRSRPPPAEDDDEDAERRSPTPE
RTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKSQTTSERRYEVLSQQPFTLDH
APRVTLRMRSHRVPSGRSTRFILNVQAKPTADVTWYHNGAPLQEGGRVRCTNTSGVLTLE
ILDCQAEDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEEVPKAVFPELTKTE
AYAVSSFKRTSELEAASSVREVRSEMTETRESISSYEQYASAEVKSAASEERSLEERATA
RKARTTLAARILTKPRSLTVREGEAARFSCDTDGEPVPAVTWLRGGRAVSTSARHQVTTA
KYKSTFEISSVQASDEGGYSVVVVNSDGQQEAQFTLTVQRAKAAEKAVASPPRVKSPEPR
VKSPETAKSPKRVKSPEPVTSPPKAVSPTETKPVPTEKARELPAAAPPKITQSLRAEAAR
DIAKLTCAVESSALCAKEVTWYKDGRKLKENGHFQFHYSADGTYELKIHNLSESDCGEYV
CEVSGEGGISKTSFQFTGQSFKSIREQVSSISETKKSAQKTAEATEAKKAEPAAPESVSS
KPVIVTGLQDLTVSSDSVAKFTVKVTGEPQPTVTWTKDGKAIAQGNKYKLSKDKEEFFLE
ILKTEASDGGLYACTITNSAGSVSSSCKLTIKAVKDTEAQKISTQKTAQVTSQKKASIQE
ETSQKARTSEEIKMSEVKSHEKLAIKEEASKVLIAEEVKKSAAASLEKSIVHEEVTKTSQ
ALEVKTHAEIKAMSTQMSITDGQKVTLKANIAGATDVKWVLNGVELANSEEYRYGVSGSD
QTLTIKRASHRDEGILTCIGRTSQGIVKCQYDLTLSKEISDAPAFISQPRSQNINEGQNV
LFSCEISGEPSPEIEWFKNNLPISISSNISVSRSRNVYTLEIRNASVSDSGKYTIKAKNF
HGQCSATASLTVLPLVEEPPREVVLKTSGDTSLQGSFSSQSVRMSASKQEASFSSFSSSS
ASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSRMLTAGGRGIPPKI
EALPSDISIDEGKVLTVACAFTGEPTPEITWSCGGRRIQNQEQQGRFHIENTDDLTTLII
MDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 98744 nt NT seq  +upstreamnt  +downstreamnt
acttgaaagtgtcttggtactgcggagacaagaaaatcaagccatcgcgcttcttccgga
tgacacagtttgaagacacctaccagctggagattgctgaagcctttccagaggatgaag
ggacttatactttcgtggccaataatgccgtgggccaggtgtccagcaccgccaccctga
ggctggaaggagaactctcggaggagggagttgaaggcctgggaactgctcgaggtgcct
tttctgactctgaagacacagacagccactccctgatggctaggcgatatgccaggagaa
cggcatccatgagctcctggcctgagtgtctcaagccgacgctgactcagaaactcacat
ttcagtacgcttttgagggtgaacctgctgtgttcaggtgcaggctggttgcttgcccag
ctccggaggtgacctggttccataataacaggcccatcccaacaggtcttcgccgggtca
tacaaacagagagtgacttacaccggcactcttcctgcttagaggtgaagagggtccaag
gccgagattccgggagttacaggttcttggcagttaatagcgaggggtcggccgagtcca
gtgcatcgttgcacgttatccagaaagggcaagatgagagatacttagaatttctgaaaa
gggcaggacagacctgtgaaaacatagggtccgtaggtgaaaggcgaggagagaggatta
aggttgacctgaggtttactggctccccctttaacaaaaagcaagatgtagaacagaggg
gaatgatgagaacaatccactttggaaccacaggccctgttagagtgggctgtgtgtatg
gggatgagtggtcagaaagcaagccggatatcagagggtggcttcatgtaggtgaaagtt
tcctagatgaggaaacgaaaatgaagctgcagcggttacgggaggccagaaaagtcttcc
tagagaagaagaaattctctcttttagacacatcgtctgaaataagctcaaagaccatga
gaagtgaggattttgttagagacgctccattctctacagaggaggtgaagagtgggtttg
tgtgggagcttgctggagacagggatagggctaataactcagctgaaagaatcatccaaa
atccacactcccttcctaatcaaatacatcaaaatagagaaaccccaccaagtgtccaag
agactggtgatgaagacgttctccagactgaaagtaccctgggccaagagaccttcccag
aagaaagcccaccaaagggcgacttgtatgagagcgtcctagtaagtgcagacatgcaag
caagggagcagtttgaagaggctgtgaacagcatcatgatcacggaatcagcaatgttca
cctctggtcaggaaacacatgaatgtaagagtgaggtgctatgtaacgctcctgaaaaga
tctctcaagttctcacaccatattccagtgaacctctggatacacttgtaaagattaaag
aaagtgaagatgtggatagtgaagaagcaacacagagggcttggagagaagagcaggact
ctgcttctatgaaagcagaagaactcaacactgagcaggaggagaaaacaagacctatcg
aacattacttccaaagacatccacagcgttgcccaccttcatttctgcagggtattgaca
cccaagaagtttatgagggtgatagctgtaaatttgtatgtcactttcaagggtaccctc
agcccatagtgacatggtataacaatgagctgcccataccacgtagtcaaggctttacca
ctgttacattcgagaactactcaacgttaaccttccctgctgtacagcctcaacatagtg
gctctgttacctgtgtgctctttaaccagtatggaacagtgaaagccatggggatgctta
gagtgaggccaaagccaaggtatgatttccagcatcctaaggtcccagtgtggcctgact
acacagatgaagaggaggagctggccttggtgtttgaccaggccaaaagtactcacccat
ctttcagtcaagagagccaagagcaccttcatatgctaccaacacaccccctgaagctcc
cctctgcagaagcagagctgctctccttccctgtagaaattcaaataactgcagccactc
caaccccagaacaggacagagaacgcagggaactacctgagttggagcctgaggcaacat
ctcgagatcaaactatgcactctccaaaacacaagtttatattctcctctgatattacca
atgaaccgccaaaaatattacaggaaatgccaaggaatgccagttgtagggaagggaatt
ctataatgctagaatgcttaatatcgggagagcctcagccagtggtcacatggtttcata
acggagccatggtaaagcagaccccgaagttcgaggtcgaggaagttaattgtagctaca
ggttatatatcaatgatgtaaattcacaagattctggaagatatgaatgtgtggccgaga
acagttcaggcatcgctgagaacatgttagatttaactgtagaacctatctcttataggg
aatatagtcgtttggaaaatgtaagtggaatttatgcacaatattccaaaaaccaacaag
cacacattcaagaaggctctataaggacacacttttatgatgacccagttcgtccttttg
ctgcccaatcaaatacaaaagaatatactataagggagtattttcaaagccttgagacag
ttgggcaggcaactgggaaaaatgaggtatactgtacaacttctgatgaaaaagtaccca
aatctatgcagggtgcttctagacccaccgacatcagtatgcctcacagagctgaattcc
tacagggccaagatgagggtcatgtaagggaacggtctcagccacaccagacagaggaca
ctgcttacccagctggtgatgatttcagggaagccaatatcagaaaagaaggcagagatg
attttggaaatagagggccagaatggggaaacactgaagggcattctcaaagtgattatg
tccattccaagaggacctctgatgcagttcggggcacagaaggctcactttacactacct
gtgaggaagcccttgaaggagaatggtactatccagggaaaagggtgaagcataaagtca
ttgcatttgaaaagctgcatcgtgcagaaaagggagtttttgaaaaaagacggaccaaga
aatcatttgttagctccccgcagaagaaaccagatgatctagagttctcgttaaagcaaa
aagaatcaggctccagcgatctgagaggaaatgtgcatccggcggtggaaatgtcttcac
acccagaagcagatttatctagcatcgtgatggatttgaagcagctttcttctcaggctc
atgggaaactggaaatggaagagagggaacaacaggaagaaatgcttcctcttgatcgaa
ctgtagtctcagaaaaggttgagttggaagcacctgtcacgtttgacctaaagcagtttc
actcacagacagaaagtgcaagaataacggtccaagacttggccaatggcctacaaggtg
aaggctctttaacaactcaacaacctgcttcagaaacagctaatcctgaagacattgtct
ttgatctaaagcaaatgtattctcacatagaagagccaggcacggtgttccagggccaag
aaactgaaagcaaggaagaaaagcacaacgaagaggacatttctatctgccagaactttc
agtacgcacaggaacaaaacacggcaattttaaaaactgaccatgcacttaagcctttct
ctgaagcagtcgatgaatcatgggttttatttcagacttcatctgctgacacaggagaaa
gtcatgtttctgagaagaatggttctgtagaaaacggagaaaggagtttcatctcacagt
tgaaaagggcagccagtgagggagagcttttgggggatcatgaaacggaagaggaatcca
ccttgacaccagcatttggtgtgactcagggatacaccagaactctggatgaccccagag
gggatgttcagcaggcagacacgcctcacagacagctctctctgagtcagtgcttgccat
tcttggtgactggagagcagcaggatcccgatgaacagagaggtgaaacgactgaggcct
caggagaagaaatctctcaggaagttcatgttcaaactgaaagctctttctccactgtgg
aaggagagaagatagaaacttgttttcctgaacatcttcctagagcagaggaggcccaga
cagctgaaacgaggggatctgagacctccctaacacagtacttacttgctgtgggaaagt
gtgaggtacctgaagctagagacaccaaccataaggcaggactcatccagagtgactcag
tcacttcaatggaggttgaggaagtgactttcaacaccgtgtatgaatattacaagcaga
gacaggactccttggggcggccctattctcccgagtctgatatctccattgatgtgggaa
gtacaagtagtgagatgtctgagttagatcagttctacagcccaccatcctctgtagagc
atctagagtctcccaagcctcccgattcatattttaaaccttcagtaactgagcaatatg
tagcaaattcaagaggtgagactctagagagatactcgacacctttagaggaaaatgggg
aaagatactctaccccttctgaaggtgaagtaccagaaagatactccacaccctcagggg
agcctctagagagatactccactcccccaggagaggccctggagagatactccactcccc
caggggaggccctggagagatactccactcccccaggggaggccctggagagatactcca
ctcccccaggggaggccctggagagatactccactcccccaggggagaccctagagagat
actccactcccccaggggaggccctagagagatactccactcccccaggggagagactag
agggagattttgttcctactagaggaccaaaccaaactagaaatgtaaacatgaacctgt
caaaaatagagagggaagacagcacggcaaatgaacatttccacacgcctacggaagaga
ggagctcatcttatgaactgtggcgttccgattcgttcggcacccccaatgaagctgttg
agcccaaagacaatgaaatgcctccatcttttctcgaacctctaagcaaaaggaaggtat
acgagaatacaacactgggcttcatcgttgaagttgagggcctcccggtccctggcgtga
aatggtatcgaaataaatctttgctggagccggatgacagaatcaaaatggagagagtgg
gcaacgtgtgctctctggaaatttctaacgttcagaaaggagacgggggagagtacgtgt
gccatgcggtgaacatcatcggggaggcgaagagctttgcaaaggtggacgtaatacccc
aagaggaaagagctgtggccctcccaccaccagtcacccaccagcacatcatggagtttg
acttggaaaacaccaactcatcaaggacaccctctcctcaagagattgtcctggaagtgg
agctaagtgacaaggaggtgcaggaatttgaaaagcaggtgaaaatagtcacagttcctg
aatttactcccgatcataaaagcgtgattgtgagtttagacattctcccgctgaatttag
cagatcccagcaaggaggccagagggaaagagggcacagattttaacattgatttggaag
catttgaaatgccccctcgattcataacacccgtttgcgattttcgaattccagaaaatt
ccgatgctgtgttcaaatgctcagtcatcggcatccccgcccccgaaatcagatggttta
aggagtatatgtgcattgagccagatgacgagaagtacataattagcgaggagagaggta
gtcactgccttaagatccgagacgtcggcccttccgatagtgcaacatacaggtgcagag
ctgtgaatagtgtgggcgaggccatctgccgaggcttcctcaccataggagaatcccagg
tgtccgccgtgaccatgaggacaagcaaggtgactttaagcagtcagaaggaggaattag
tcttaaggagcaaatatgcagacagcttttttgaattccaggtggtggaaggccccccca
gatttatcaaagaaattgctagtattctgtctgccgaggatggttttcagacgtgtagtt
ctgatcttggcttacctaatgtgaatgaaacacttgaacttctgtctgagcctccagctt
accccactcagtttgattccagacaggaaggcgctgccccggttttcatccgagaaatag
cagatgccgaaataagcattgaagacgtagctaagctgtctgttactgtggttggcagcc
ccaagcctaagattcaatggttctttaatggggtgctcttaaccccttctgctgactaca
aacttgtctttgatggggataaccacagcctgatcattctgttcaccaagtttgaggatg
aaggggagtacacatgcgtggctagtaatgactatggcaaagcagcatgtagcgcttatc
taaaaataaaccccaaagcagagatggaagcagcagagaagaaagctccagagaagcctg
aaggaccgtgcccaccttactttttcagggagttaaaaccagtccattgtgctccaggga
cccctgctgtctttgagtacctggtgcacggagagcccacccccaccgtttcgtggttca
aagaaaacataccgctttataccagtgtgcgttacaccatcattcacaatccagacggct
ccgggaccttcattgttaatgaccctcagagccgagatagtggcctgtacatctgcaaag
cggagagcgagtggggggagtccacctgcgctgctgagcttctcgtgcttcccgaggaca
cagatgcgacggatgcctcctgcaaagcagagtccacctcaggagttcctggtggttttc
tggaaacatctgcaaggggctcttcggttgaggcatttgatgcacagcaggaaattacag
cctttgtcaaggatgccatttcggaagctgctttaattgcagaagaaaggctgcagcttt
cttctgtgcatgatgctggcagcagtgaaatgagtactggggtgagcataagggctcagg
ggctgcagcccgttgccgcatctactccacagagcactggggaacggccttccattgcgg
ggactggtcacacccagcaagtcagagagccgccccccactttacacctgcagaccgtcc
agcccgagggaagccttcccagaggagacagtctacagttcgaagagcctgaagaaatcc
tccctagtccctcacctgcagcacaagtgagctcagtcactgtcaagcctctgataccct
tgacagctgaacaggaagggggtcatccacagccttcagcagctgctcctgctcattcag
ctctatcctcggtggctgaagaaacacttcagccagaggaaacgttggtctctgaagcag
acaaggagcagagagctctccttctgagtcagagctcagatgagggacatgtggaaagtt
tagagggccctgatgttgtgatctctaatgtgcagccagaaccctgggtccctttccaac
acacatacacagaagaaggcaaaatcctgatggcaaatgcagacccactagaaagcgcag
ggcaagatgccgccgtgaggacggaggagagcaagtccctatacttcccactagcacttg
aggaaaagcaggtcctcctcaaggaagagcaatcagagaacatggcagtgcccaccagcc
aaacatccaagtctcagaaagagcctgaggcagtaaagggagtgaaggaggtacagggaa
gggacctgctttctaaggaagcttcaattcctggtcttcctgaagagcagcgatcacatc
tgaaaacccaggtccgcagggctttgcaggctgcagtggccatggagcaagcaagtcttt
tctctgagtggctaagaaacattgacaaggtggaggtcaaagccgtaagctgtactcaag
aacccaaacgcatactgtgcacctacgttatcacttcagtgacctcactacctgaagagc
taaccatcactattgaaggtgtagatccccaaatggccaacctgaaaactgaactcaagg
atgctgtgtgttccatcatatgtgaagagagaagcatcttaatggccgaggacccgagat
ttcggaaagaagacaaactaggtgtgcagggagcgagagagcccttctcagaggcacaga
aagttgaaaccaccatagaagcacaagctgagtctaagtatcttgtctccaaagaagagg
tcagttgtttgagtgtggaaagtcagttcaaagctggagatactgatgaggttccaaagg
ctgagacgctgaagccagcagaagagagtggtacccagaaggctggcacagtagagtcac
aggaagctgagcactgcccgaccatacttaagcacctggtagataccatttctgaggaag
gtgatactgtccaccttacagcatctatagcaaatgctaaggaggtgaactggtatttca
aggggacactggtgccttcagatacaaagttcaagtgttcacaagatcagaacgcctaca
ctctggaaatccacacggtaaaggcagaggatgaaggggagtatgtctgtgaggcctcaa
atgacagcggaaaagcagcgacctcagcaaagctcactgtaggagaaagagccgcccctg
tgatcaaaaggagaattgagcctctggaagtagctctgggccacctagccaaattcactt
gcgagatccaaggtgcccccaacgtccggttccagtggttcaaggctggccgggaaattt
atgagagtgacaagtgctctatccgctcttccaattatatctccaccctggaaatcctga
gaacccaagtcgtggactgcggcgagtacacatgcaaagcctccaatgagtacggcagcg
ccagctgcacggccgcgctaactgtgacagaggcatacccaccaacctttctctccaggc
ccaagccccttacgactttcgtgggtaaggcagccaagttcctctgcacagtgtcaggga
cacccgtgatcgagaccatctggcaaaaggatggcactgccctcgcgccgtcgcccaact
gcaggattgtagacgcagacaacaaacacagtctagaactctccaacctcaccattcagg
acaggggcatttactcttgcaaggcttccaacaaattcggagcagatctctgccaagccg
agctgaccatcatcgacaagccccgcttcattaaggagttagaggctgtgcagtcagcca
tcaataagaagatccaccttgagtgccaggtagatgaagacaggaaagtcaccatcacgt
ggagcaaagatgggcagaaactgcctgcggggaaagattacaagatctactttgaagata
aaatagcatcgctggagattcctctggccaaactgaaagattccggaacctacacatgta
cagcttctaacgaggctgggagcagttcctcagctgccgcagttactgtcagagaaccac
catcctttgtgaagaaggtggacccctcttacttaatgctcccgggtgaatcagcacgcc
tccactgcaagctgaaaggttcgcctgtgatccaggtcacttggtttaaaaataacaaag
agcttagtgaaagtaacacagtccgaatatcttttgtcaattccgaggccatccttgaca
tcactgacgtaaaagttgatgacagtggcacgtactcctgcgaagccaccaatgatgtgg
gcagcgacagctgcagtactgaagtagtgatcaaagagcctccttctttcatcaaagctc
ttgagcctgcagacatagtgcgaggggcgactgcgctgcttcagtgtgaaatcgcaggca
ccggaccctttgaaattagctggtttaaagacaagaagcagattcgaagtagtaaaaagt
acaggctgttcgctcagaagtcttccgtgtttctggaaatcgcgtctttcaatagcgccg
atgttggcgattacgaatgtgtagtcgctaatgaagttggaaagtgtggctgtgtcgcaa
cacacttattaaaagaaccaccaacctttgtcaagaaagtagatgactttacagccctag
cagggcaaacagttaccttacaagctgccgtgagaggctcagaacccatttctgtcatgt
ggatgaaaggccaagaagtcattaaagaagatggaaaaatcacgatgagcttttccggtg
gagttgcggtcttgaccatccctgatgtgcagattagtttcgggggcaaatatacatgcc
tggctgaaaatgaagccgggagccagacatcggttggggaattaatagttaaagaacctg
ccaaaatcattgagcgagcagaactggtccaggtgaccgcaggggacccagccacgctgg
agtacaccgtctcaggcaccccggaactcaagcccaagtggtacaaagatgggaggccat
tggttgccagtaaaaagtaccgaatcagttttaaaaacaatgttgcccagctgaagtttt
actcggctgaactccatgacagtggccagtacacatttgagatttccaatgaagtgggca
gcagctcctgtgaaaccacgtttaccgtgctagatcgagacattgctccacttttcacga
agcccttgcgcaatgtggacagtgttgtcagtggcacctgcaggctagactgcaaaatcg
ccggctctctccccatgagggtgtcctggtttaaggatggcagagaaatcgctgcttccg
acagataccagatagcgtttgtggaaggcacagcctccttggagatcagcagagtagaca
tgagcgatgcagggaatttcacctgtcgggccaccaattccgtgggcagcaaagatagca
gcggagccctgattgtgcaagaaccacccagctttgtaactaagccagggtccagggacg
tcctgcctggctcagcagtctgcctgaagagtgctttccagggatctgcccctcttacca
tcagatggtttaagggagacaaagagctggtttctggtggaagctgctacattaccaaag
aagctttagagagttccctggaactctatgcagtgaaaacctcggactcgggcacttaca
catgcaaagtcagcaacgtggcgggcagtgcggagtgcagtgcagccttgtttgtgaaag
aacctgctacatttactgaaaagttagagctgtcacaactgttaaagaagggagatgcca
ctcagctagcctgcaaagtcacgggcacccctccaattaagataacatggttcgtgaatg
acagagaactgagggagagcaacaaacacaaaatgtctttcgtggagtccacggcagttt
taaggcttacggatgtggccattgaagacagtggtgaatacatgtgtgaagctcagaacg
aggctggcagtgaccactgcgctagcattgtcctagtcaaagaggcaccttactttacga
aggagtttaagcccattgaggtattaaaggagtatgacgtcatgctgctggctgaggtgg
caggcacccctccctttgagatcacttggttcaaagacaacacaaccctgcggagcggta
ggaagtataaaaccttcattcaggatcagctggctagcctgcagatcctcaagtttgtag
ccgcagatgtgggtgaataccagtgccgggtgaccaacgaggttggcagcagcacctgca
gtgccagggtgacgctaagagaacccccagccttcattaagaagattgagagcaccagct
ccctccgtggaggcacggccgccttccaggccacactgaaaggctccctgcccatcactg
tgacttggctaaaagacaacgatgagatcaccgaagatgacaatataagaatgacttttg
agaacaacgtggctagtctgtatctcagcggtattgaagtcaagcatgacgggaaatatg
tctgtcaagccaaaaatgatgcaggcatacagaggtgttctgcattactctcagtcaaag
aacctgcaacaataacggaggaggcggtgtccatagatgtcactcaaggagacccagcca
ctttgcaagttaaattttcagggacgaaggagattacagccaaatggtttaaagatggcc
aagaactcagcctgggcccaaaatacaaaatcagtgtcactgacaccgtctccatactga
agattatttccacagagaagaaagatagtggagaatatacttttgaggtccaaaatgacg
ttggcagaagcagctgcaaggctaggattaatgtcttagatcttatcatacctccttcat
ttaccaaaaagctgaggaagatggacagcattaaagggtcgtttattgacttagaatgta
tagtggctggatcacaccctataagcatccagtggttcaaagatgaccaagaaatatcgg
ccagtgacaagtacaaattctctttccatgacaacactgccttcttagagataagtcagc
tggaaggcaccgacagtggcatgtatacctgctccgccaccaacaaggccgggcacagcc
agtgcagtggccatctgacggtcaaagagcccccttacttcatagaaaagccacagtcac
aagatgtgaatcccagcacaagggttcagttgaaggctcttgtgggtggcaccgtgccca
tgacaataaagtggtttaaggataacaaagagctgcaccctggggcggctcgctcggttt
ggaaggatgacacctccaccattctagagctcttttcagccaaagccgctgactctggga
cttacatttgccagctaagcaacgatgttggcaccgcaagcagtaaagctaccatctttg
taaaagaaccccctcaatttattaagaagcccagtccagggttagtgctgaggaacgggc
agtcagcaacatttgaatgccaagtaacaggtaccgccgagatcagagtgtcttggtatc
tggatgggaatgaaataacagatgctaggaaatacggcatctcctttgtggatggtttag
ctactctccagatttctaatgccagggtagagaacagtgggacatatgtctgtgaagctc
gaaatgacgcgggcaccgccagctgcagcatcgagctaaaagtgaaagaacctcccagct
ttatcagggagctggagcctgcggaggtggtaaaggacagtgacgtcgagctggagtgtg
aagtcatggggacaactccgtttgaagtcacctggctgaagaataacagggaaatcagga
gcggcaaaaagtacaccatgtccgagaaaatgtcagtgttttaccttcacataaccaagt
gtgacccttcagatgttggtgactatcagtgcgtcatagccaatgagggaggcagctgct
cttgcactgctagagttgccttgaaagaaccaccgtcgttcatcaaaaagatagaaaatg
tcaccactgtcttgaagagttccgccacctttcagagtactgtggcaggctcacccccca
tttctgtaacctggctgaaagatgaccagattcttgaggaaagtgacaacgtccatatct
catttgtggacggggtggccacacttcaggtccggagtgtggacgatggacacagtgggc
ggtacacatgccaagccaagaatgagtcgggagtcgagaggtgtcatgccttccttttag
tgcaagaacctgctcaaatcatagagaaagctaagtcggtggatgtcaccgagaaagacc
cggtcaccttggagtgtgtggtggctgggacaccagaactcaaagtcaagtggcttaaag
atgggaaacaaattgtgcccagtagatacttttcgatgagttttgaaaataatgtggcca
gtttcagaatccagtcggtcatgaaacaggacagtggccagtacacgttcaaggtggaga
atgactttggaagcagtagctgtgacgcctacctgagagtgttagaccaagatattcccc
cctcattcaccaaaaagttaaccaaaatggataaagtgctgggttcctccattcacatgg
agtgcaaggtttccggatcacttcctatcagtgctcagtggtttaaagatggaaaagaaa
tatctacaagcgcaaagtacagacttgtgtgccgtgaaaacaccgtgtcgctggaagtca
gcaatctggagctagaagacactgccaattacacctgcaaggtgtctaacgtagcaggag
atgacgcctgtagcgccatcttaaccgtgaaagagccaccaagcttcttagtgaagccgg
agagacagcaagctatccctgatgccaccgtcgagttcaaggccgtgctgaaaggaacac
caccattcaaaattaaatggcttaaggaccaggtggagctcacctcgggacctaaatgtt
tcattggcttggaaggctcagccagcttcctaaatctctactcggtagacgcttccaaga
ccggacagtacacctgccaagtcaccaatgacgttggcagcgattcttgcactacagtgt
tgcttgtgacagaaccaccgaagtttgtaaagaaattagaagcatccaaaatagtgaaag
caggtgactcagcacgcctggaatgcaagattaccggatccccagaaatacaggttgtgt
ggtacagaaatgagcatgagctcgcagccagcgataagtaccagatgactttcatcgact
ccatggcagtcttgcagatgaacagcctcgggacagacgacactggagattttatctgtg
aggcccagaatcctgctggcagcaccagctgcagtaccaaggtcatagtaaaagaaccac
ctgtttttagcagcttccctcctgtagtagaaacccttaagaacaccgaagtcagtcttg
aatgtgagctttcaggaacaccaccctttgaggtggtgtggtacaaagacaagcgccagc
tccgaagcagcaagaagtacaagatcgcatcaaagaatttccacgcgagcattcacatcc
tcaacgtggagtccacagatattggcgaataccactgcaaagcgcagaacgaagtgggca
gtgacacgtgtgtttgtgctataaagctaaaagaaccaccaaaattcacttccaagctga
acagcctcacagtggtggctggcgagcctgccgagctgcaggcctccatagaaggtgccc
agcccatttctgtccagtggcttaaagagaaggaggaagtgatcagagagagcgagaaca
ttcggatttcttttgtgaacaacactgcgacgctgcagtttgctaaagcggagcccgcta
atgctgggaaatacatctgccaagtcaagaatgatggtggcgtgagggagagcatggcca
cagtgaccgtcttagagcccgcagtcatcgtagagaaggcaggctccgtgacggtgactg
tgggagaaacgtgtgcgctggagtgtaaggtggctggcacccctgagctctttgttgaat
ggtacaaggatgggaagctcttgaccagcagccagaaacacaaatttagcttctacaaca
agatctcttccttaaaagtcctctcagttgagaaggaggacgcaggcacctacacgttcc
aggtgcagaacaacgtcggaaaaagcagctgcacggccacggttgacgtgtcagaccgaa
tggtgcccccctcgttcacgcgaagactgaaggacacgggtggggtcctgggctcttctt
gcgtcttagaatgtaaagtagctgggtcttcccctatctccattgcctggtttcatgaga
aaaccaagatcgtcagcggagcaaagtaccaggcagccttttccgataacgtctgcacgc
tgcagctgaactccctggacgcctcggatacgggcagttacacgtgcgtggctgctaacg
tggccgggtctgacgagtgccgcgccctgttgaccgtacaagagccgccctctttcgtga
aggagcctgagccgctggaagtccttcctggcaagaacattaccttcacaagcgtcatca
ggggaacccctcccttcaaggtgggctggtttcggggcgcccgggagctggtgaaaggag
acaggtgcagcgtctatttcgaggacacggtggcagagctggagctgttcaacgtcgacg
tctctcagagcggggagtacgcctgtgtggtctccaacgacgcgggccgagcatcctgca
ccacgcgcctcttcgtgaaagaaccagcctcctttgtgaagagactgagtgaccactctg
tagagcctgggaagtctgtgattctggagggcacctatactgggacgcttccaatttctg
tcacctggcgcaaagacggcgtcagcgtggctccatctgaaaggtgcagcattgtcacca
cagagaaaacttgcatcctggagattctgagcagcacaaagggagatgcagggcgctact
cctgtgagatagagaacgaggcaggaagggacgcctgcgaagccctggtctccatgctgg
aaccaccttattttgttacggagttagaacctctggaggcatcggttggagactcggttt
ccttgcaatgccaggttgctgggacaccagaaattacagtgtcttggttcaaaggagaca
ccaagctaaggtcgactccggaatataggacctacttcacaaacaacgtggccacactcg
tctttaataaagttagcatcaatgacagtggcgagtacacatgcgtggcagagaacagca
taggaaccgcagcctcgaagaccgtcttcagaattcaagagcgccaactcccaccttcct
ttgccagacaattaaaggacattgagcaaacggttgggctgccagttactctcacctgcc
ggctgaatggctctgcgcccatccaagtgagctggtacagagacggggtgcttttaagag
atgacgaaaacctgcagatgtcatttgcagataatgtggccacgttaaaaattttgcaaa
ctgacttgagtcactctggccagtattcttgctcagcctccaacccgcttggcacggcgt
cctctactgctaggctgacagcaagagaacctaagaaatcacccttctttgatatcaagc
cagtatcaatagatgttattgctggagaaagtgcagattttgagtgtcatgttactggcg
ctcagccgatgagaatcacttggtcaaaagataacaaggagatccgacctgggggaaact
acactatcacgtgtgtgggtaacactccccacctgcggattcttaaagtgggcaagggag
actcgggtcagtacacttgtcaagccaccaatgatgtgggcaaagacatgtgttccgccc
agctcagcgtgaaagaacctcccaagtttgttaagaaattagatccttcaaaagttgcga
agcagggagaatccatccagctggagtgtaagataagcggctccccggaaatcaaagttg
tgtggttccggaacgacagcgaacttcacgagagctggaaatacaacatgtcctttgcta
actctgtggcactgcttaccatcaatgaggcctgcgccgaggacagtggggactacatct
gtgaggcccacaatggcgtcggtgatgccagctgcagcacggccctcaaagttaaagcac
ctcccgtttttacccagaagcctcctccagtcggagccctgaagggctctgatgtgatcc
tccaatgtgaactttcgggaacaccccccttcgaagtggtgtgggttaaggatcgaaagc
aagttcgaagcagcaagaaatttaaagtcacctccaaaaatgtcgacacgagtcttcaca
tctttaatcttgaagcccctgacgtaggggagtatcactgcaaagccactaatgaagtgg
gaagcgacacgtgtgtttgcactgtcaagttcaaagaaccaccacggtttgtgaaaaagc
tcagtgacgcgtccaccctcattggggagcctgtggagttacaagccgtggtagaaggtt
ttcagccgatttctgttgtctggctgaaagataagggcgaagtcatcagggagagcgaaa
acatcaggatttcctttgttgataacattgcaactctgcagctgggaagtccggaggcct
cgcattctggaaaatacgtgtgccaaatcaaaaatgaggccgggatgagggagtgctctg
cggtcctgactgtgctagaaccagccagaattgtggagaagccggaacccatgactgtca
ccactgggaatcccctggcactggagtgtgtagtggctgggactccggaactttcagcca
agtggttcaaagacggtagagagctttctgcgggcggcaggcatcagatcacgtttgtta
gaaacctggcttccctgaagatcccctcagcggagatgaatgacaagggcttatatagct
tcgaggtgaagaacagtgttggcaaaagcagctgcactgtgtccgtccacgtctcagatc
gcattgttccgccttccttcatccggaagctgaaggacaccagtgccacccttggggcct
ctcttgttctggagtgccgggtgtcaggctcggccccaatttcagtcggctggttcctgg
atggaagcgagatcgccagcagtcccaaatgccagcccagcttttctgataatgtctgca
ctctgaagctgagctccctggagccctccgacactggcacctacacctgcgtggctgcca
atgtagccggccaggatgaaagctccgcagttctgactgtccaagaacccccatcttttg
agcaaacccccgaatctgtggaagttttgcctggaacgagcctgacgttcacgtgcgtta
ttagaggcacccctcccttcaaggtcaagtggtttaagggcagcagggagctggcgtcag
gggaggcatgcaccatttctttggaagactttgtcacccagctggagctcctggaggtgg
agccactgcagagtggggactattcctgcctcgtgaccaatgacgctggcagcgcttcct
gtaccacgcacctcttcgtgaaagaaccagccactttcgtgaaaagattggctgacacca
gtgtcgagacgggcagccccatcgtcctggaggctacttacacgggcacgccccccatct
ccgtgagctggatgaaaaacgagtaccctctttcacagtcccccaactgtggcattacca
cgacagagaagtctagcattctggaaattcttgaaagcacaatcgaggactacgcgcagt
acgcatgcctgatagaaaacgaagccgggcaggacatctgtgaagctctcgtgtccgtcc
tagaaccgccttactttattgaacccctggaacacgtggaggccgccatcggggagccca
caactctgcagtgtaaagtggatggaacccctgaaatcagaatctcttggtataaagagc
ataccaaactacgatcggctcctgcatataagatgcaattcagaaacaacctggcctcct
tggtcatcaacaaggtggaccacagtgacgtgggagagtacacatgcaaggcggaaaaca
gcgtgggggcggttgcttcttccgctgtgctggttatcaaagagcgtaaacttccgcctt
cctttgcaagaaaactgaaagatgttcacgagactctcggcttcccagtcgcctttgaat
gtcgaatcaatggctcggaacctctccaggtgtcctggtacaaggatggcgtacttttga
aagatgactctaacttgcagatgtctttcgttcaccatgttgccactcttcagattctgc
aaactgaccagagccatgttggtcagtataactgctcagcttctaaccctcttgggactg
cttcctccagtgccaagctccttctctcagaacacgaagtgcctcccttctttgatttaa
agcctgtgtcagtagaccttgctcttggtgaaagtggttcttttaaatgtcacgtcaccg
ggacagcaccgatcaaaatcacgtgggccaaagataaccgtgagattcgccctgggggca
actacaagatgactctagttgaaaatactgccactctgactgtgctcaaagtagccaaag
gtgatgctggccagtatacctgctatgcgagcaacgttgctggaaaagactcttgttctg
ctcaacttggtgtacaagaaccccccaggttcattaagaagctcgaccccacacggatcg
tgaagcaggaggagtccacgagatatgaatgcaaaataggcggctctccggaaatcaagg
ttttgtggtataaggatgaggtcgaaattcaagagagcagtaagttcagaatgtcgtttg
aggactcggtggcggtactggaaatgcatggtctcagcgtggaggacagcggggactaca
cctgtgaggcccgcaacgctgcaggaagcgccagcagcagcacctccctgaaggtcaaag
aaccacccactttccgcaaaaagccttttcctgttgagacgcttagaggagccgatgttc
acctggagtgtgagctgcgggggacgcctccctttcaagtttcttggcacaaagacaaga
gggaactcaggagcgggaagaagtacaagatcatgtctgagaatttgctcaccagcatcc
acatcctgagcgtggacgcggcggacgtcggggaataccagtgcaaagccacaaacgacg
tcgggagcgacgcctgcgtcggctctgtcactctgaaagcaccacctcaatttgtgaaga
agctcagcgacatctccaccatcatcggtaaagaagtccagctgcaggcaacagttgaag
gcgctgagcccatttcagtggcgtggttcaaagataaaggggaaatcgttagagaaagtg
acaacgtatggatttcttactctgaaaacgttgcgaccctacagttttccagagcagagc
cagccaacgctgggaaatacacctgccaggtcacaaacgatgctggggcacaggagtgct
ccggcacgctctctgttctcgagcccgcagcagttgtggaaaagccagagaacattaagg
tcaccgcaggagacacctgtaccttggagtgcaccgtgtctggaacacctgaactcagca
ccaagtggtttaaggacggaagggagctctcgagtgacagcaaatacaagatcagcttct
tcaacaaagtgtcaggccttaagatcatcggtgcggcacctggagacagcggggtgtaca
gctttgaagtgcaaaacccagtcggcaaagacagctgcactgtctccgttcaagtctcag
atcgaattatccccccttcgttcacaagaaaactgaaagagacgaacggcctgtccggct
cctccattgtgatggagtgcaaggtccacgggtcacccccgatctctgtctcgtggttcc
acgaggggaatgagatcagcagtggccggaaataccagaccactctgacagacaacacgt
gtgccctcaccgtgaacatgctggaggactcggatgctggagactacacgtgcatagcca
caaacgtggcgggctcggatgaatgcagtgcccctctgactgtgagagagccaccatctt
ttgtgcagaaaccggactccatggacgtcttgacgggcggtaatgtcaccttcacaagca
ttgtaaaaggaacacctcctttcagcatcagctggttcaaaggtagcagcgagcttgtgc
ccggggccaggtgcagcgtgtccctgcaggactcggtggctgaactggagctctttgatg
tggatacgtcccagagcggggaatacacttgcatagttagtaacgaagctggcaaggctt
cctgtacggcacatctctttgtgaaagccccggccatatttgtgaagaggctcaatgact
acagcatagagaaaggcaagcctctgatcctagaagggaccttctctggaacccctccca
tctctgtcacatggaagaaaaacggcataaatgtcgctgcttcccaacggtgtaatatca
ccacaactgaaaagtcagcgatcctagaaattctgagcagcgcagtcgaggactcagggc
agtataactgctacattgaaaacgcttctggcaaagactcctgttccgcccagatcctga
tactagaaccaccgtattttgtcaagcagctagagcctgtgaaggtgacagttggcgatt
ctgcctccttacaatgccagcttgctggaactcctgaaatcggggtctcctggtacaaag
gtgacacaaagctgaggcccactgccacctgcaagatgcattttaagaacaatgtggcta
cgctggttttcacccaggttgacagcaatgacggtggagaatatatctgcagggctgaaa
atagcgtgggagaagtttcctcatcaactttcctgaccgttcaggagcaaaaacttccac
catcattttctcgacaactgagagatgtgcaagaaactgtggggctgccagtggtgtttg
aatgtgccataagagggtcagagcccatctccgtgacttggtacaaagatggcaagccgt
tgaaagacagcccaaatgtacaaacatcatttttggacaacgtcgccactctgaacatct
ttaagacagacaggaatctcgcaggacagtactcctgcacagctacaaaccccattggct
ctgcttcttctagcgccaaactcatcctcacagaggggaagaatccgcccttcttcgaca
tccctctggcccccgtggacgctgtggttggagaaagtgctgacttggaatgccacgtca
cgggcacacagcccatcaaggtcagctgggccaaggacaacagagagctccgcagtggcg
ggaactaccagatcagctacctggagaacagcgcgcacctgaccatcgtcaaggtggaca
aaggagactctggacagtacacctgctacgccatgaacgaagtggggaaagactcctgca
cagcccagctcaacataaaagagcgcctgatcccaccgagcttcacaaaaaagctatccg
agacagtagaagagacagaggggaactcgttcagactggaagggcgtgtggcaggttccc
agcctatcactgttgcttggtacaaaaataatgtagagatccatccgacttccaactgtg
agatcacgttcaagaacaacacactgctcctgcaggtcaagagagccagcatggccgacg
caggcttgtatacctgcaaggcaacaaatgatgcgggctctgccctgtgcacgtcttcca
ttgtcatcaaagagcccaagaaaccacctgtgtttgaccagcacctcaccccggtaacag
tcagtgaaggcgattttgtgcagctcagctgccatgtgcagggatcagagcccattcgga
tacagtggttgaaagccggcagagagataaagccttccgagagatgcagcttcagctttg
ctagtgggacagctgtgctggagctcaaggagacagctaaagcagatgcgggagattatg
tgtgtaaggcttccaacgtggctggaagtgacagttccaagtgcaaagtgaccattaaag
aaaaaccagctgcagccccagcagccaagaaagcagcggtggatgggaaactcttttttg
tgtcagagcctcagagtatcagagtagtggaaaagaccactgccacattcattgcaaaag
ttggaggtgaccccatcccgaatgttaaatggacgaaaggcaagtggagacagctgaacc
aaggaggccgcattctgatccaccaaaagggagacgaagcaaagctggagattcgtgaca
ccacgaaaaccgactctgggctctaccgctgtgttgcctttaacaagcatggggaaatcg
agagcaacgtcaatctacaggtggacgaaaggaagaagcaggagaagattgagggcgacc
ttcgtgcgatgctgaaaaagactccagccctaaagaaaggctctggggaagaagaggaaa
ttgacatcatggagcttctcaaaaatgtggatcccaaagagtatgagaaatatgcacgca
tgtacggaatcaccgatttccggggcctccttcaggcctttgagctgctgaagcagagtc
agcaagaagagactcacagactggaaattgaggagctggagaagtcagaaagagacgaaa
aggaatttgaggaacttgtatcatttattcagcaaaggctgacacagacagagcctgtca
ccttgatcaaggatatcgaaaaccagacagtgctgaaagataacgatgccgtctttgaaa
ttgacattaagattaattatccagaaatcaagctctcctggtacaagggcactgaaaaac
tggagccaagtgacaaatacgaaataagaattgacggggaccggcacacactcagagtca
aaaactgtcagctcaaagatcagggcaactacaggctcgtgtgcggaccccacattgcta
gcgccaagctgactgtgattgagcccgcttgggagcgccacctccaggacgtcactctga
aagaaggccagacctgcaccatgacctgtcagttttccgtgccaaacgtgaaatccgagt
ggttccgaaacggcagaatcctgaaaccccaaggccgagtgaaaacggaagtggagcaca
aagtccacaagctgaccatcgcagacgtccgagccgaggaccagggtcggtacacctgca
agcacgagggccttgaaacttcggcagagctcagaatcgaagccgagccgattcagttca
caaagcgcatacagaacatcgtggtgagcgagcaccagtccgccactttcgagtgtgagg
tgtccttcgacgacgccatcgtgacctggtacaaaggacccacggagctgacggagagcc
agaaatacaacttcaggaacgacggccgctgccactacatgaccatccacaacgtgaccc
cggatgacgaaggtgtctactctgtgatcgcacgcctggagcccagaggcgaggccagga
gcacggcggagctgtacttaaccacgaaagaaataaaactggagatgaagcctcccgaca
ttcccgattccagagttccaatcccaaccatgcccatcagagccgtccctcctgaagaaa
tccctcccgcggttgctcccggcatccctcttctgctgccattacctgaggagaagaagc
caccaggaaagcgtgtggaagtgaccaaaaaggctgtgaagaaagacaccaaaaaagttg
ttgcaaagcccaaggaagaggcaccaccaccgccagtcgccaagaagcccccacctccga
ctcccatgattccagcaaaaacttctgaaattattgatgtgtcctctaaggctgaagagg
tgaaaattacaaccatcaccagaaagaaagagattcataaagaaaaggaggctgtgtacg
agaaagagcaagccgtctacgagaagagggttctcatagagccctgggaagagccctacg
aggagctggaaacggagccttacacggagtatgaggagccctattacgaagaaccggatg
aagactacgaagaggtccaggtggaggccaaaaaggaaatccatgaggaatgggaggaag
acttcgaagaaggccaagagtactacgagagggaggagggctatgacgaaggggaggaag
agtgggaagagacttatcaagaaagagaagtgatccaagtccagaaggaggtccacgaag
aattacacgagaggaaaaccccagccaaggtgcctgagaagaaagcaccacctcccaaag
ttgtaaagaagccagtagttgaaaagattgaaaagacatctcgaagaatggaggaagaaa
gagttcaagtcaccaaagtacctgaagtttccaagaagattgttccacaaaaacctttcc
ggactccagtgcaggaagaaataattgaagtgaaagtaccagctgtgcacacaaagaaga
tggttatctctgaagaaaagatgttctttgcttctcacacggaagaggaggtgaccgtca
cagtccctgaagtacaaaagaaaactgtcactgaagagaaagttcatgttgcagtttcca
aaaagattgaaccaccacccaaagtccctgaaccacctaaaaagcccattccagaagaag
tggtccctgttcccgttcctaagaaggtggaaccaccagtacccaaagttcctgaggctc
ccaagaaacctgtgccagaggagaaaaagccagttcctcttcccaagaagaaagagccag
ccgctcctccaaaagtcccagaggctccaaagaaacctgctcctgaagagaagattcctg
ttcctgtgacaaagaaggaagcacctccagctaaagttcctgaagtgcagaagaaagttg
tcacagaggaaaaaataaccatcattactcacagggaggagtccccaccccctgcagtgc
cagaaataccaaagaagaaagttcccgaagaaagacgacctgttcctcagaaagaggaag
cccccccgccaaaagtgccagcgcctaagaaagctgtccctgaggagattgccccagctc
ccatccctaagaaagctcctccccgagctgaagtttctaagaaaactgttgtcgaagaga
aaagatttgctgctgaagaaaaactatcggtggctgtgccccagagagtggaagtcatgc
ggcatgaagcatctgcagaggaggaatgggcttactctgaagaggaagaaagagtgtctg
tttcggtgtacagggaagaagaaagagaggaggaggaagcagagatcacagaatatgaag
tgatggaagagcctgaggagtatgtcgtggaagagaagatgcactttatctctaagaagg
tggaagttgaacccgccaaagtgccagagaagcgtgaaaagaaaattataccaaaaccaa
aagttccggctaagattgaggagccaccgcctgctaaagttcccgaaccaccgaagaaaa
ttgtaccagagaagaaagttcctgcgccagctgctaagaaagaaaaggtgccaccagcca
aagcacctgaagagccaaggaaaccagttccagaaaggagagttcctgcagaagtggttg
agatagaagaacctctcccaaccaaagtgaccgagaggcacatgaaagttacccaggaag
aaaaaattcttgtggctgtaactaaaaaggaagagcctccgagagcgagagtgccagagg
aacctaagaaagttgtccctgaagaaaaatttcccaaactcaaacctcgaagagaggcgg
agccaccagctaaagtgaccgaagtcaggaaaagagctgttaaggaagagaaggtatcca
ttgaagttccaaagagagaactgcgacccactaaagaagtaactgtaacggaagagaaga
aatgggcttatacccgagaagaggagaccatctccgagcaccgggaggaggagtatgagg
attatgaagactatgaggagtataaagaatatgaggagtacgagcccacggacgaatacg
accaatatgacgaatacgcagagcgcgaacagtacgaggaacatgaagagcatgaagaat
atgccccagaacccaagaagcctattccagcaaaacccacccaagaaccagtacctgcca
aacccaaggcccccccaccaaaagtgctgaagaaagctgtccctgaagaaaaaccacctc
ttctcattcaaaagaaactcaaacctctaccacccaaagctcccgaagaaccaaagaaag
ttgtggaagaaaaaatacaaatttcaattaccaaacgggaaaagcagcaggtgactgagc
cagctgccaaagtgcctacgaagcccaagagagttgtcccagaggcaaaagtacctgccc
ctaaagcagaagtgccggcacctcgcagagtgccaggagtgcctaaaaagcgagaagtag
aggaggttgtttccttcaaagaggaggtggaaacccacggagaagagtacattgtagagg
aagaggaggagctcgtccatgaagaatacgtccacgaagaggaatacgtccatgaagaag
aatatgaagcagtggtgccagtcaaagtgcctgaggtacccaagaaacctgttccagaag
agaaaaaacctgttcctgttcctaaaaagaaggaattgccgccagcaaaagcgcctgaga
ttcccaagaagccagaggaaaaagttgctgtgcctattcctaaaaaggagaaggccccac
ccgccaaagttccggaagtgcccaagaagcctgtaccagaagaaaaggcaccagcacctg
ttcccaaaaaggtggaaacacctccagccaaagtgccagaggtgcccaagaaacctgtgc
ctgagaagaaggtgccagttcccgctcccaagaaagcagaggctccacccgcaaaagtgc
cagaggcgcccaagaagctcattccagaggaaaagaaaccaacacctgttctgaaaaaaa
tggaagctccaccccccaaagtgccaaagaaacgggaagtagtctcagttcctgtggctc
ttcctcaagaagaagaagctccatttaaggaagtcattgttcctgaagaggaactgccac
ctgaggaagaagaagttctacctgaggaggaggaagttctacctgaggaagaagaagttc
ctgcagaggaagaagctcttcctgaggaagaggaagttccacctgaggaagaggaagctc
ttccagaaattaaacctaaggtgccacgacctgcaccagtgcctgagatcaagaagaaag
ttccagagaagaaaatagttgttcccaagaaagaggaggctcctcccaccaaagttcctg
aggtacctaagaaggtggaggaaagacggatcatcccccctaaagaagaggaagtgccac
cagctgaagtgtatgaggaagctgaagaacccactcctgaagagatcccagaagaaacac
ctagcatagaggaggaggaggtggtagtggaggaagaagaggaggaggtggtggtgctcc
ctaaagcccctgaagtggttaagaaagcagtgcctgccgcacccactcctgtccccaaga
aagtggagccgcctcccacaaaagtgccaaagaaaattcctgaggaaaaggttcctgttc
ctgtcccgaaaaaagaggctccaccagccaaagtgcctgaagtaccaaagaaagaagttc
cagaaaagaaagtccctgtgcccaaaaaggaagttgttccccctgctaaagggaaagctg
tttttgaagaaaaaatatcagtttcttaccagcaagaggaaatagtccaagaaagaagag
agttagaacttgtggaagcagaggtagaagaggctttcgaggaggaagagttccacgagg
tgcaggagtacttcgaggaggaagagttccacgaggtgcaggagttcatcagagtagaag
gacgcaggttccaggaggagcacaaagccgaacaaatccacagagtcattgagtttttag
aggctgaagaagtggaagtttacgagaaacccaaaatcccacctaaaaaaggacctgagg
tatctgagaaagtcattcctccaaaaaagccacccactaaagtcgttcctcgaaaagagc
caccagctaaagtacctgaggtgaccaagaaaacggtggttgaagaaaaagttcgtgttc
ctgaagaacccaaggctccaccacctaaagcacctgaagtgcctaagaaaatcgctccag
aagaaaaagtccgtgaagctgttcctaaaaagcctgaagttccaccacccaaagtgcctg
aggagcccacagaggtcatccctgaaaagaaagtgtctgtggtgcctcctaaaaagccca
aagccccacctgtcacagtgcctgaggcccccagagaagctgtccctgaaaaggaagtgt
ccatggtgcctccgaaaaagccagaggccccacctgccaaagtgccagaggcaccccagg
aagtcatccctgagaagaaagtgccagtagcacctaagaaaaagccagaagcccctcctg
tgaaagtgccagaggcaccccaggaagtcatccctgagaagaaagtgccagtagcaccta
agaaaaagccagaagcnnnnnnnnttaaagtgcctgaggtgccaaaggcagctgttcccc
aaaagaagacacctgaagccatttcccccaaagcagaaagtcctccccctgaagtgtatg
aggaacctgcagaggagattgccccagaagaacctccagaggaggctgtggaagagccaa
tgccggctccacctccaaaagtgtcagcaccacctaagaagcctgtccctgagaagaaag
tgcccccagctgttgccaagaaacctgaacccccaccagcagtgaaagtacctgaggtgc
ccaaggaagctgtccctgaaaagaaagtgcctcctgcggttcccaaaaagccagaagcgc
cacctgctaaagtgccagaagttccgaaagttgtcgtcccagaaaagaaagtggctgtcc
ccaaaaagccagaagttgcacctgccaaagtgccagaagtgccaaagaaacctgtcattg
aagagaaaccagccattcctgttcccaagaaagtggaatcgcctcccccggaagtgtatg
aagaacctgaagaagtggttgctgaggaggaggagccagtccctgtggtcgaagaggaag
aatacgaagctccgcctctgcctgcaccagtgcctgaggagccaaagaaggtggtcccag
agaagaaatttcctgtcatcaaaaaaccagaagctctgcctcctaaagaacctgagcctg
aaaagaaggtgattgagaaaccaaaactcaaaccaaggcccccagcacctgttccttctc
cacctaaggaagatgtgaaggagaaaatattccaacttaaagctgtgtcaaagaagaaag
tccctgaaaagcccgaggttgtggaaaaagtggaaccagcaccactgaaagtgcctacag
ctgaaaagaaagttcgcaaattacttcctgaacctaagcctcagccaaaggaggaggtgg
tgctgaaaagcgttctaagaaagagacctgaagaagaagaacctaaagtagaacctaaaa
aagtagaaaaagttaaaaaaccagaagagccacaaccacctccaaaagctgttgaagctg
aagctcctccagagcctaaaccaaaggaaaggaaagttccagaaccaagcaaagttcctg
aaattaagccagcaatacctctccctggacctgaaccaaagccaaagcccgagccagagg
tgaaaaccatgaaagcgccgcccatcgagcccacgcccacgcccatcgccgcccccgtga
cggtgcctgtggtcggaaagaaagcagaagccaaacctaaggatgaagcagccaagccaa
aaggtcccatcaaaggtgtagccaagaagacgccttcaccgatagaagctgaaaggaaaa
agctcagaccaggaagcggtggagagaaacctcccgacgaagccccattcacctaccagc
tgaaggccgtgcctctgaagttcgtgaaagaaatcaaagacatcgtcttgacagaggcag
agtcggtgggctcctctgccatctttgagtgtttggtctccccatccaccgccatcacaa
cctggatgaaggacggcagcaacatccgggagagcccaaagcacaggttcatcgcggacg
gcaaagacaggaagctgcacatcattgacgtccagctttctgacgctggcgaatacacgt
gcgtgctgcgcttgggaaataaagaaaagacctccacagccaagctcatcgtagaagagc
tccccgtgcggttcgtgaagacgctggaggaggaggtcacggtggtcaaggggcagccgc
tctacctgagctgtgagctgaacaaggaacgagacgtggtctggagaaaggacggaaaga
tcgtggtggagaagcctggcaggatcgtgcctggggtcatcggcttgatgcgggccctga
ccatcaacgacgcagacgacactgatgcggggacctacaccgtgaccgtggagaatgcca
acaacctggaatgttcttcctgcgtaaaagtggttgaaatcatccgggagtggctggtga
aacctatccgagaccagcatgtgaagcccaaggggacggctgttttcacctgcgacatag
ccaaggacacaccaaacattaagtggttcaaaggatatgatgagatccccatggagccaa
acgacaagacggagatactgaaagagggaaaccatctcattctcaaggttaagaacgcca
tgccagaggacattgacgagtacgcagtggagattgaagggaaaagatacccggcaaagc
tgacgctcggagagcgtgaggttgagctgctgaagccgatagaggacgtcacggtgtacg
agaaggagagtgccagcttcgatgccgagatctccgaggaagacattcccggggagtgga
agctgaagggagagctcctgaggccctcacccacctgcgagatcaaagctgagggtggca
aacgcttcttaaccctgcacaaagtgaagctggaccaggctggcgaagtcctctaccagg
cgtgcaacgcggtcacaacggccattctgacggtcaaagaaatcgagcttgactttgcgg
tacccctgaaggacgtgactgtcccagagaagcgacaggcccggtttgagtgtgtcctca
ccagagaggccaacgtcatctggtctaaagggcccgacatcatcaaggcatccgacaagt
tcgacatcatcgccgacggaaagaagcacatgctcgtcatcaacgattctcagttcgacg
acgaaggcgtctacactgccgaggtagagggcaagaagacgtcggcacagctgtttgtga
caggcataagactgaagttcatatcgcctctggaagaccaaacagtgaaggagggggaga
cggcgacctttgtctgtgagctgtcccacgagaaaatgcacgtggtctggttcaagaacg
acgtcaagctgcacacaaccaggacggtgctcatgtcatccgaggggaagacgtacaagc
tggagatgcgggaggtgaccctggacgacatctcccagatcagagcccaagtgaagaacc
tcagctccacggccaatctgaaggtcttggaggccgacccctacttcaccgtgaagctgc
acgacaagaccggcgtggagaaggacgagatcatcctcaagtgcgaagtgagcaaggacg
tgccggtgaggtggttcaaagacggcgaggagatcgtgccctcgcccaagcattccgtca
agaccgacggcctgcgccgcatcctgaagatcaagaaggcggagctcaaagacaagggcg
aatacgtgtgcgactgtggcaccgacaccaccaaggccaacgtcacggtggaggcccgtc
tcatcaaggtggagaagcctctgtacggcgtggaggtgttcgtgggcgaaacggcgcgct
ttgaaatcgagctgtccgagccggacgtgcacggccagtggaagttaaagggggagccct
tgaccgcgtctcctgactgtgagatcatcgaggacgggaagaagcacgtcttggttcttt
acaactgtcagctggatatgaccggggagatttccttccaggccgccaacgccaaatcgg
cagccaacctgaaagtgaaagaattgccgctcattttcatcacacctctcagcgacgtca
aagtctttgagaaagacgaggctaaatttgaatgcgaagtgtccagggagccgaaaacgt
tccgctggctgaaaggcacccaggagctggcaggggatgacaggtttgagctcatcaagg
acggtaccaggcatgcgctggtcatcaagtccgccgccttcgaggatgaagccaagtaca
tgttcgaggcggaggacaagcgcacgagcgccaagctgatcatcgaaggcatccggctca
aattcctaacccccctgaaggacgtgaccgccaaagagagggaagacgccgtgttcaccg
tggagctctcccacgacaacatcccagtgagctggttcaagaacgaccagcgcctgcaca
ccagcaagcgggtctccatgcacgacgaagggaaaacgcactccatcacgttcaaagacc
tgtctatcgacgacacctcccagatcagggtggaggctatggggataagctcagaagcca
agctcaccgtcctggagggagacccctatttcacggggaagcttcaggattacacgggcg
tggaaaaggatgaggtggttcttcagtgtgagatcagcaaagcagatgcacccgtgaagt
ggtttaaggacgggaaggaaataaagccatctaaaaacgcagttattaaggctgatggca
agaagcgaatgctgatcctcaaaaaagccttaaaatctgatattggccagtatacctgcg
actgtgggacagaccagacttccggaaagctcgatattgaagatcgggaaattaagctgg
tgcggcccctctacagtgtcgaggtgatggagaccgagacggcacgcttcgaaactgaaa
tctccgaggacgacatccatgccaactggaagctcaagggagaggcgctgctccaaacac
ctgaatgtgagattaaagaagaaggcaagatccatgttcttatcttacacaactgtcaac
tggatcagaccggtggcgtagatttccaagctgccaatgtcaaaaccagcgcccacctcc
gagttaagccgcgggtaattggtcttctgaggcctctaaaggatgtcacagtgaccgcag
gggaaacagccaccttcgactgcgagctctcttatgaggatatcccagtggaatggtacc
tcaaagggaagaaactggagcctaacgaaaaggtggtgacccgttcggaagggagggtcc
acacactcaccctgagggatgtgaagctagaggatgctggcgaagtccaactaacagcga
aggatttcaaaacccaggccaacctctttgtgaaagaacccccagttgagttcactaagc
ctcttgaggaccagacggtcgaagaggaggccactgccatacttgaatgtgaagtatcca
gagaaaatgctaaggtgaaatggttcaaaaatgggacagaaatcctcaagagcaagaagt
atgaagtcgtcgctgatggcagggtcagaaagctcattattcatggttgtaccccagagg
atatcaaaacgtacacttgcgatgctaaggattttaagacttcctgtaacctgaatgttg
ttcctcctcatgtggaattcttaagaccactcacggaccttcaagttaaagaaaaagaaa
cggctcggtttgagtgtgaaatttccaaggaaaatgccaaggttcagtggtttaaagatg
gtgctgaaattaagaagggcaaaaagtacgatatcatttctaagggagcagtacgcattc
ttgtcgtcaacaaatgtctgctgaatgatgaagcagaatattcctgtgaagtgaggacag
cgcgaacttccggcatgctgacagtcctagaggaagaggctgtcttcacaaaaaatcttg
ccaaccttgaagtgagtgaaggagacaccatcaaactggtatgcgaagtctccaagcctg
gggcagaagtgatttggtacaaaggggacgaggagatcattgaaacaggaagatttgaga
tacttactgatggaaggaagagaatcctggtcattcagaacgcgcagctcgaggatgctg
gcagctacaactgccgactccccagttctcgaacggacagcaaagtcaaagttcatgaac
ttgctgctgaattcatctcaaagccacagaaccttgaaattcttgaaggagaaaaggctg
agtttgtctgcaccatctcaaaggagagcttcgaagttcagtggaagagagacgatcaga
cgctggaatccggagataaatatgacgtcatcgctgatggcaaaaagagagtcctggttg
tgaaggatgccacactacaagacatgggcacttacgtggtcatggttggggctgccagag
ctgcggctcacctgacagtcattgagaaactcaagatcatagttcctcttaaggacacca
aggtaaaagaacaacaagaagttgtcttcaactgcgaagtcaatactgaaggtgccaaag
ccaagtggttcagaaatgacgaagccatatttgacagttccaagtatatcattctccaaa
aagacctggtttacaccctcagaatcagagatgcgcggttagatgaccaagccaactaca
gcgtgtctttgaccaaccacagaggtgaaaatgttaaaagtgcagccaatctaatagtag
aagaggaagatcttaggattattgaacccctgaaagatattgaaacaatggagaagaaat
cggtcacattctggtgcaaggtgaatcgtctcaatgtgacactgaagtggaccaaaaatg
gagaagaagtggctttcgacaaccgtgtatcataccgaattgacaagtacaagcactctc
taatcatcaaggactgcggctttccagacgaaggcgaatacattgtcactgccggacagg
accagtctgtggcggagctgctcatcatagaagccccgacagagttcgtggagcacctgg
aagaccagacggtcacagagtttgacgacgctgtcttctcctgccagctttccagagaga
aagcaaacgtgaaatggtacagaaacggaagagaaatcaaggaaggcaaaaagtacaaat
ttgaaaaagacgggagcatacacaggctcatcatcaaagactgcaggctggaggatgagt
gtgaatacgcttgtggtgtagaggacaggaagtcccgggcgaggctgtttgtagaagaaa
tccctgttgagattatcaggcctcctcaagacattctggaagcacctggagcagatgtta
tctttttggctgagctcaacaaagataaagtggaggtccaatggctgagaaataacatga
ttgttgtccagggtgacaagcaccagatgatgagtgaagggaagattcacagactacaga
tttgtgatattaagccacgcgaccagggtgaatacagatttattgccaaagataaagaag
ccagggctaaacttgaattagccgctgcacctaaaatcaagacggctgaccaagatctgg
tggtcgacgctggccagcctctgaccatggtggtgccctatgatgcctaccccaaagcag
aggctgagtggtttaaggagaacgaacctctgtccacaaaaactgttgataccacagccg
agcagacctcattcagaatcgtagaagccaagaaagaagacaaggggaggtataagatcg
tgcttcagaacaagcacgggaaagcagaaggcttcatcaacttacaagttatcgatgttc
ccgggccggttcggaacttggaagtgacggaaacattcgacggtgaggtcggcctcgctt
gggaagagccgttaacggatggtggaagcaaaatcataggttacgtcgtcgaaaggcgtg
acatcaagaggaagacctgggttctggtcaccgaccgagcagacagctgtgagttcacgg
tcactggcctacagaaagggggagtggagtacctgttccgtgtgagcgcacgcaacagag
ttggcactggagaaccagtggaaaccgacagtcctgtggaagccaggagtaaatacgatg
tcccgggcccgcctctgaatgtagccatcacggatgtgaatcggtttggcgtctcactga
cttgggagccgccagagtatgacggaggtgccgaagtcacaaactatgtgattgaactga
gggacaagacttccatcaggtgggacaccgccatgaccgtgagagctgaggacctgtcgg
ccactgtcactgatgtggtggaaggacaggagtacagtttccgtgtcagagcccagaacc
gaatcggagtcgggaaacccagtgcggccacacccttcgtcaaagtggctgatccaatcg
agagaccaagtcctcctgtgaacctgagtgcctcagatcagacacaatcatccgttcagc
tcacgtgggagcccccgctgaaagacggaggcagccccatattgggctatataattgaaa
gatgcgaggaaggaaaagataattggattcgctgcaatatgaaacctgtgcctgagctga
cttacaaggtcactggattgaagaaaggaaacaaatatttatatcgagtgtctgcagaaa
atgcagctggtgtttcagacccgtctgagatccttggtcctctcactgctgatgatgcct
ttgttgaaccaacaatggatttaagtgcatttaaagatggtctggaagtcatagtcccca
atcccatcaagatcctggttccaagcacaggctatccaagaccgaaagcaacctggacat
ttggagatcaagtacttgaagagggggagcgtgtgaaaattaagaccatatcagcctacg
ccgaacttgtcatttctccaagtgaacggactgacaagggcatttacaccctcacattag
aaaaccctgtgaagtcgatttctggagaaattgatgtcaacgtaatcgctcccccaagtg
cacccaaagagctgaaatacagtgacgtaactaaggattccgtacatttgacttgggaac
ctccagacgatgatggaggaagtccactaaccggatatgttgttgagaagagagatatga
gccggaaaacatggactaaagtcatggactttgtgactgatctagaattcacagttcctg
atctcgtccaaggaaaggaatatctgttcaaagtctgtgctcggaacaagtgtggccctg
gtgctcctgcgtatattgatgagcccgtgaatatgtccgcacctgcaacggtacctgacc
caccggagaatgttaaatggagagataggactgcccagagcatcttcctaacatgggatc
ctcctaaaaatgatggtggctcacgcatcaaaggatacatagttgaaaaatgcccccgtg
gttctgatcgatgggttgcctgtggagagcctgttgcagatacaaaaatggaggtgacag
gtcttgaggaaggcaaatggtatgcctaccgtgtgaaggccttgaacaggcaaggtgcca
gcaagccaagcaaacccaccgaagaaatccaggcggtggacacacaggaggctcctgaga
tcttcctggatgtgaagctccttgcaggtctcactgtaaaagccggaacaaagattgaac
ttcctgccaccgtgactgggaaacccgaacctaaagtcacctggacgaaagccgacacca
ttctgaagccagaccagagaatcaccattgaaaacattcctaagaaatccaccgtgacaa
tcacggacagcaagaggagcgacacgggcacatatatcgtagaagccgcgaacgtgtgcg
gccgggtcaccgcggtggtagaagtgaatgtcctggataaacccggaccgccagctgcct
ttgacatcacagatataaccaacgagtcatgtcttctgacgtggaacccaccgagagatg
acggtgggtcaaaggtcacaaactacgtggtggagaggagagccacagacagcgatgtgt
ggcataagctctcatcgaccgttaaggacacaaacttcaaggccaccaagttaacgccca
acaaggagtacgttttccgcgtggctgcagaaaacatgtatggcgttggtgaacccgtcc
aagccgctccaatagtagccaagtatcagtttgatccacctggacctccaactcgcctcg
aaccttccgacatcactaaagatgctgtgacgctcacctggtgtgagccagacgatgatg
ggggcagccccatcaccgggtactgggttgaaaggttagatcctgacacggataaatggg
ttcgatgcaataagatgccagtgaaggacacaacatacagagtgaaaggcctcaccaata
agaaaaagtacagattccgtgtgctggctgagaatttggcaggaccgggaaagccaagta
gatcaactgaaccaatcttaataaaggaccccatagatcctccatggccccctggaaaac
cgactgtaaaggatataggcaaaacatcactagtactgaactggaccaagccagagcatg
acggaggggcaaagattgagtcttatgtcattgagatgctaaagactggaacagacgact
gggtcagagtggctgagggggtcccgaccacggagcacttgctcaccgggctgatggagg
gacaggagtactcattccgagtgcgagctgtgaacaaggctggagagagcgagcccagtg
aacccagcgaccctgtgctttgccgggagaaactatatcccccgtcaccacctcgctggc
tcgaagtaattaatatcacaaaaaatacagctgacctgaaatggacggttcccgagaaag
atggagggtcacccatcaccaactacattgtggaaaagagggatgtgaggcggaaaggct
ggcaaacggtggacaccacggtcaaggacaccaagtgcacagtaacccccctgacagagg
gctcgctgtatgtgttccgagttgccgcagaaaatgccataggacaaagtgactacactg
aaattggcgactccgtcctggccaaagacaccttcaccacccctggaccaccctatgccc
tgacagtggttgatgtgacaaagcgacacgttgacctaaagtgggagccacctaaaaatg
atggtggaagacccatacagagatacatcattgagaagaaggaaaaactaggcacccgtt
gggtaaaagctggaaagacctcaggccctgactgtaacttcagggtaactgatgtcattg
aaggaacagaagtccagtttcaagttcgggccgaaaatgaagcaggggttggtcacccaa
gtgagcccacagaaattctgtcaattgaagatccaacaagtcctccctcacctcctcttg
atctgcatgtgactgatgctgggagaaaacacattgccattgcttggaaacctccagaga
aaactggcggcagccctatcataggctaccatgttgaaatgtgtccagtaggcactgaga
aatggatgcgagttaattctcgcccaattaaagatttgaagttcaaagttgaagaggggg
ttgttccagacaaagaatatgttctgagagtgagagccgtcaatgctgttggtgtcagtg
agccatctgaaatctctgaaaatgtggttgccaaagacccagactgcaagccaacaattg
atctagagactcatgacattgttgttatcgaaggtgaaaagctaagcattcctgtgccct
tcagagctgtcccagttccaaccgtgagctggcataaagacggcaaagaagttaaagcaa
gtgacaggttaacaatgaagaatgaccacatctctgcacaccttgaggttcccaagagtg
tccatgctgatgctggtgtttacaccatcaccctggagaacaagctcggctcagcaactg
catccatcaacgtcaaagtcataggtctgcctggtccgtgcaaagatattaaagcaagtg
aaatcaccaagagttcctgtaagttaacatgggagcctccagaatatgatggtgggagcc
caatccttcattatgtcctggagcgtagagaagccggcaggaggacatacataccagtca
tgtctggcgagaacaaactggcctggaccgtaaaggatctcataccaaacggcgaatact
tcttccgagtgaaagcagtcaacaagattggcggaggcgaatatattgagctcaagaatc
ccgtcattgctcaagaccctaagcaaccacctgatccacctgtcgatgttgaggttcata
atcctacagccaaggccatgactatcacctggaaaccgcccttgtacgatggagggagca
agatcatgggttacatcatagagaagcttgttaagggtgaggatagatggaagagatgca
acgagcacctggtgcctgtcctgacctacacagcaaaaggactcgaggagggaaaagagt
accaattccgtgtgcgagcagagaacgctgcgggtataggcgaaccttctcgggccactc
ccccagccaaagctgtagatcctgttgatgccccaaaagtcatcctcaggacaagcctgg
aagtaaagcggggtgatgaaatagcacttgatgcaaccatttccggctcaccttacccaa
caatcacatggataaaagatgacaatgtcataataccagaggaaattaagaagcgagcag
cacctcctgttaggaggaagaagggagaagctgaagaagaggagccgtttttcctgcctc
tgacagagcggttgagcatcaacaatagcaaacaaggagaatctcagctgcgtgtccggg
attctctgcggcccgaccacggccagtacatgatcaaagttgagaatgaccatggtgttg
caaaagcaccttgcactgtcagtgtgttagacacaccaggaccgccaatcaactttgtat
ttgaggatatcaggaagaactctgtcctctgtaaatgggaaccgcccctggatgatggtg
gcagtgaaatcattaactataccttggaaaagaaagacaagaccaaaccagactcagaat
ggattgttatcactgcaacactcagaaactgcaaatattcagtaacaaaactgatcgaag
ggaaagagtaccttttccgtgtgagagctgaaaataggtttggacctggaccaccatgtg
tctcaaagccgcttttagccaaagatccatttgaaccacctgatgccccagataaaccca
ttgtggaagatgtcaccagcaacagtatgctggtaacatggaatgagccaaaagataacg
gtagccccatcttgggctactggcttgaaaaacgggaggtcaatagcacccactggtccc
gtgtcaacaaaacccttctcagttctttgaaaaccaaggtagatggcttattagaaggac
tcacctatgtcttccgagtctgtgctgaaaacgctgcgggacccggaaagttcagcccac
catcagatcctaaaacagctcgcgacccaatctcaccgcctgggccacctgtccccagag
ttgctgacaccagctctacaaccattgaactggagtgggagcccccagctttcaatggtg
gcggcgagattattggctactttgtcgacaagcagttggttggcacgaatgagtggtctc
gctgcacagagaagatgatcaaagtgcgtcagttcaccgtcaaagaaatccgcgaggggg
ccgattacaaacttcgcgtgagtgctgtcaatgcggccggcgaagggccacctggagaaa
cggaacctgttactgtggctgaaccacaagagcctccgaatgtggagctggatgtttctg
tcaagggcggaatacaaatcatggctgggaagactcttagaattccagctgtggtgacag
gccgtccggtgcccacaaaagtatggaccatagaagaaggggagctggacaaggaacgtg
ttgtaatagagaatgttggaaccaaatctgaactaattatcaagaatgcactgagaaaag
accacggcagatatgtgatcacggcgacaaatagctgtggtaccaaatttgcggcagtcc
gggttgaagtgtttgatgtcccgggcccagttcttgatctcaaacctgttgtaacaaaca
gaaagatgtgtctgcttaattggtctgatccagcagatgatgggggaagtgatatcacag
ggtttataattgaaagaaaggatgccaagatgcacacttggagacaacccatcgagaccg
acagatctaaatgtgacatcacaggtcttatagagggacaagaatacaagttccgtgtca
ttgccaagaacaagtttggttgtgggcctccagttgaaataggaccaattcttgcagttg
atccactaggccctccaacatctcctgaaaggcttacgtatacagagaggacaaaatcca
ctatcacacttgactggaaggagccccgcagtgatgggggaagccccgtccaagggtata
tcattgaaaaacgccgccacgacaaacctgactttgaaagagtcaacaagagactctgcc
caaccacatcatttctggttgagaaccttgatgagcaccagatgtatgagtttcgtgtca
aagctgtcaatgacattggtgaaagcgaaccatctctgcctcttaacgtggtcatacaag
atgatgaagtccctccaactatcaagctgcgcctggctgttcgaggagacacgatcaaag
ttaaggccggagagccggtcaacatccctgcagatgtgacgggactccccatgcctaaga
ttgagtggtccaagaatgagaaagtgattgagaaacccactgacgcgcttcagataacca
aggaagaagtatcccgaagtgaggcgaagaccgagctcagcatccccaaggcagtcaggg
aggacaaaggcacttacacaattacagcttccaatcgtcttggctccgtgttccgcaatg
ttcacgtggaggtatatgatcgtccatctccacccagaaacctcgctgttaccgacatta
aagctgagtcctgctacctgacgtgggatgcccctcttgacaatgggggcagtgaaatca
cccattacgtcattgacaaacgtgatgccagcaggaaaaagtctgaatgggaagaggtca
ctaacactgctgttgagagaagatacgggatctggaaacttatccccaatggtcagtacg
agttccgggtgagggcagtgaataaatatggaatcagtgatgaatgcaaatcagacaaag
tcgtcattcaagatccttatcgcctccctggacctcctggaaaaccaaaggtcttagaac
gcaccaaaggctctatgcttgtgagctggactcctcctttggacaacggaggttctccaa
ttactggctactggctagagaagagagaggaagggggcgcctactggtcacgtgttagcc
gagcaccaatcaccaaagtaggactgaaaggtgtggagttcaatgtcccacgtttgattg
aaggagtgaaatatcagtttagagccatggcaataaatgctgcaggaattggccctccca
gcgaaccgtcagacccagcggttgccggggatcccatataccctcctggggcaccttctt
gcccagaggttaaagataaaacaaaatcgagcatctcgctaggatggaaacctccagcca
aagacggtggcagccccatcaaaggctacattgtagaaatgcaagaggaaggtaccactg
actggaaaagagtcaatgaacctgacaaacttctcactacctgtgaatgtgtggtgccca
atctgaaagaactcaggaagtacaggttcagagtgaaagctgtcaatgaagctggtgaat
ctgaaccaagtgacacaactggagagatccctgccacggatatccaagaggttccagagg
ttttcattgacattggagcacaagactgcctggtttgtaaagctggctcccagatcagga
tccctgctgtcatcaagggacgcccaacaccgaagtcatcttgggaatttgacggaaagg
caaagaaggcaatgaaggatggagtccatgatatacctgaagatgcacagctggagactg
ccgaaaactcctcagtcatcattatcccagagtgtattcgagctcactcgggcaaataca
gcatcacagccaagaataaagcaggacagaaaactgccaactgcagagttaaagtcatgg
atgcaccaggccctcccaaagatctgaaggtcagtgacatcacaagaggtagttgccgcc
tctcgtggaagatgccagatgatgacggaggagacaggatcaaaggctacgtgattgaga
agaagacaattgatgggaaagcctggacgaaagtcaatccaaactgcggaagcaccacct
ttgtggtgccagatctcatctctgagcagcagtacttcttccgtgtgcgagcagaaaacc
gtttcggaattggcccacctgcagaaaccattcagaggaccactgccagagacccaatat
atcctcctgaccctcccattaaactcaagattggtcttattacaaagaacacagtacatc
tgtcatggaaacctccaaagaatgatgggggctctcctgtcacccactatattgttgagt
gtctcgcctgggaccccacggggaagaagaaagaagcatggagacagtgcaataagcgtg
atgtggaggagctggaattcactgttgaagaccttgttgaaggtggggaatatgaattca
gagtcaaagctgtcaacgaggccggggtcagcaagccttcagccactgttggtcctgtga
ctgtcaaagaccagacatgcccaccgtcaattgagctaaaagaattcatggaagttgaag
aagggactgatgttaacatcgtggccaaaattaaaggagtgccgttcccgactctcacct
ggtttaaagcgcccccaaagaagcctgatagcaaggaacctgttgtctatgacgcccacg
tcaacaaacaggtggtggatgacacttgcaccctagttattcctcagtcccgccggagtg
acactggcctatattctattacagccgtcaacaacctgggtacagcatcaaaggagatga
gactgaacgttcttggtcgtcctggaccccctgtgggacccataaagtttgaatctattt
cagcagatcaaatgacattgtcttggctcccacctaaagatgatggtgggtctaagatta
caaactatgtcatagagaaaagagaagccaacagaaagacatgggtacgtgtctccagtg
agcctaaagagtgcatgtacaccattcccaaattgctagaaggccatgaatacgtattcc
gcatcatggcccagaataaatatggcattggagaaccacttgacagtgaaccagaaacag
cacgcaacctcttctctgtcccgggagctccagataaaccaacagtgagcagtgtcaccc
gtaactccatgactgtcaactgggaagagccagaatatgacggaggctctcctgtgactg
ggtattggttagaaatgaaagacaccacttcaaagagatggaagagagttaaccgagacc
cgatcaaagccatgactctgggtgtttcttataaagtgactggtcttatcgaaggttcag
actatcagttccgggtatatgcaatcaatgctgctggagtgggtccagcaagtcttccct
cagatccggtgactgcgagagatccagttgctccccctggtcctccattccccaaagtga
cagactggacaaagtcatctgtggacttagaatggtctcctcccctaaaagatggtggat
ccaaagtaactggatacattgttgaatataaggaagaaggaaaagacgaatgggaaaagg
gtaaagataaagaagtaagaggcacaaaactcgttgtgaccggattaaaagaaggagcat
tctacaagttccgagtgagagccgtcaacattgctggtgccggggaacctggagaagtca
cagatgttattgaaatgaaggacagaattgtggtgcctgaccttcagcttgatgccagcg
tcagagacagaatagtggtccatgctggaggggtgatccgaatcatcgcttatgtgtctg
ggaagccgcctccaactgtcacgtggagcatgaacgaaagagccctgcctcaagaagccg
ccattgagaccacagccattagctcatccatggtcatcaagaactgccagcggagccatc
aaggcgtgtactctctccttgccaaaaatgaaggcggagaaagaaagaagacaattattg
ttgatgtattagatgttccaggacctgttggaataccattcctctctgacaacctaacca
atgactcctgcaaactgacgtggttctctccagaagatgacggtggctctccaatcacca
actatgtcattcagaagcgggaggctgaccgcagagcatggacccctgtgacatacacgg
tcacgcgacagaatgctactgtacagggtcttattcaaggaaaatcctactttttccgaa
ttgcagctgaaaatagtattggcatgggcccatttgttgagacaccaaatgcccttgtca
tcagagatccaataactgtaccagagagacccgaggacctggaagtcaaagaagtcacta
agagcaccgtgtctttgacttggaaccctcccaagtacgatggtggatccgaaattatta
actatgtcctagaaagccgcctcattggcactgagaagttccacagggtgacaaacgaca
accttatgagcagaaaatacacagttaaagacttaaaagaaggtgacacctacgagtacc
gtgtcagcgcggtcaatattgttggacaaggcaagccgtcattttgcaccaagccaatca
cttgcaaggatgagctggctccaccaacactggaccttgacttcagagataagcttacag
tccgagttggtgaagctttcgccctcactggccgttactcaggcaaaccaaagcctaaag
tagattggttcaaagatgaagttgacatactggaagacgatcgtacacacattaagacca
ctctcaccacacttgctcttgagaagaccaaagccaaacgctcagattctggaaaatact
gtgtggtcgtggagaacagtacaggctccaggaaaggtttctgtcaagtcaatgttgttg
accgtcctgggccgccggtaggacctgtcacttttgacgaggtgaccaaagaatacatga
ttatttcttggaagccacctctagatgatggaggaagtgaaatcaccaattacattattg
agaagaaggagctgggtaaagacatttggatgcctgtgacatctgccagtgccaaaacaa
catgcaaggttccaaaactgctggaaggaaaggattatatcttccggattcacgctgaga
atctgtatggaataagtgaccctctggtgtctgattcaatgaaagccaaagatcgtttca
gagttcctgatgcacccgagcagccagttgtcacagaggtcaccaaagactctgcattag
taacctggaacaagccaaatgacggaggaaagcccatcacaaactacatcctggaaaaga
gggaaactatgtctaaacgatgggttagagttaccaaagagcccatccatccatacacta
agtttagggtgcctgaccttctagaaggatgccagtatgaattccgggtttctgcagaaa
atgaaattggtgttggagagccaagtccaccatccaaaccagtctttgctagagatccaa
ttgccaaaccaagcccacctattaaccctgaagcaatagacacaacatgtaattcagttg
atctaacttggcagccaccacgtcatgatggtgggagcaagatactgggctatattgtgg
agtaccagaaagttggagatgaagagtggagacgagccaatcatactccagagtcatgcc
ctgaaactaaatataaagtcactggtctcagggatggtcagagctataagttccgagtgc
tagcagtcaacgaggctggtgaatcagacccagcccaagttcctgaaccagttctagtaa
aggaccgacttgaacctcctgagctgatccttgatgccaacatggcaagagaacaacaca
ttagggttggtgacacgctgagacttagtgccatcataaaaggagtgccattcccgaagg
taacttggaaaaaaggagacagagaggctcccacaaaagcacagattgatgtgactccgg
ttggaagcaagcttgaaatccgtaatgctgcccatgaagatggtggaatctattctctaa
ctgtggagaatccggctggttccaaaacggtctcagtaaaagtgttggtcttagataaac
ctgggccacctagagatctggaagtcagtgaaatcagaaaggactcttgttaccttactt
ggaaggaaccactggatgatggtggctctgttataaccaattatgtggtcgagaggaaag
atgttgccgctgctcagtggtcccctctttcaaccacatcaaagaagaagagccatatgg
ctaaacatctgaacgaaggaaatcagtacctcttccgggtagctgctgagaaccagtatg
gacgtggtccttttgttgaaacgcctaagcccatcaaggctctggatcctctccatcccc
cagggccacccaaggacctgcaccacgtggatgtcgacaagactgaagtctctctggttt
ggaataaaccagatcgtgatggcggctctccaatcacaggatacttagtggagtatcaag
aagaaggtgcccaggactggattaagttcaagactgtgaagaacttagagtgtgttgtta
ccggcttacagcaaggaaagacctatagattccgtgtaaaagctgaaaatatcataggtc
ttggtcttcctgatacaactatcccaatagaatgtcaggaaaaactagtgcctccatctg
tggaattagatgtaaagttgatcgaagggctcgtggtaaaggctgggaccacagtgaggt
tccctgccatcgtaagaggtgtgcctgttcctaccgcaaagtgggcagctgatgggaccg
agattagcacagatgaccactacacagttgagactgacagcttctcgtcagtgttgacca
tcaagaactgcttaaggaaggacactggggaatatcaactcacagtctccaatgcagctg
gcaccaaaaccgtagctgtccatcttactgttcttgatgtgcccggcccaccaacaggtc
ccattaatattctggatgtcacccctgaatacatgaccatctcctggcagccgccgaagg
atgatggagggagcccagtaataaattacattgttgagaaacaggatacaaggaaaggca
catggggagtcgtgtctgcaggaagcagtaagctgaagctgaaggtcccacacctccaaa
agggctgtgaatatgttttcagagtcaaagcagagaacaagatgggtgtcggtcctcctc
ttgactccatacctactgttgctaaacacaagttcaatcctccatctcctccgggtaaac
cagtggtaacagacattactgagaatgctgccacggtgtcctggaccctgccaaaatctg
atggtggcagtccaataactggctattatgtagaacgccgggaaatcactggcaaatggg
tgcgggtcaacaaaacacctattgctgacctcaagttcagggtgactgggctctatgagg
gaaatacatatgaatttagggtttttgctgaaaatcttgctggattaagcaatccatccc
caagttctgacccaataaaagcttgcaggcccatcaagccaccaggtccacccataaatc
ctaaactgaaagacaagagcaaagaatctgctgacttggtgtggaccaagcccctcagcg
acggtggcagccccattctcggctacgtcgtagagtgtcagaaacctggcacagcacagt
gggatcggattaacaaagatgacctcatcaggcagtgtgccgtcagggtgcccggactga
tcgaggggaatgagtacagattccgcataagagcagctaacaccgtgggtgagggagagc
caagagaactcgcagaatctgtgattgccaaagacatccttcatcctccggaagtagagc
ttgatgttacatgccgtgatgtcattaccgtccgggtaggtcaaactatccgcatccttg
ctcgagtcaaaggcagacctgagccagacataacttggtccaaggagggcaaagtgctgg
gcaaagacaaacgggttgacctcattcgtgatctacctcgtgtcgagttacaaattaaag
aagctgtcagagctgaccacggcaagtatatcatctccgctaagaatagcagtgggcatg
cgcaagggtcagccattgttaacgtcctcgacagacctgggccttgccagaatctgaagg
ttaccaatgtaaccaaggaaaattgcacaatttcttgggaaaacccattagataacggtg
gctcggaaattacaaatttcatagtagaatatcgtaaaccaaatcagaaaggctggtcaa
ttgttgcttcagatgtcaccaagagattgatcaaggccaacctcttagccaacaatgaat
actatttccgggtttgtgcagagaataaagtaggcgtcgggccaaccattgaaacaaaga
ctccaattctggccatcaaccctattgacaggccgggcgagcctgaaaaccttcatatcg
cagataaaggaaagacgtttgtctatctaaagtggcgacggcctgattacgatggtggca
gcccaaatctctcgtaccatgtcgagaggaggctgaagggctctgccgactgggaaagag
tacacaaaggaagcattaaggaaacccactacatggttgacaagtgtgttgaaaaccaga
tctatgagttcagagtacaaaccaagaatgagggtggagaaagtgactgggtaaggacag
aggaagttgttgtgaaggaagacttacagaagccagtgcttgatctaaaattgagtgggg
tgctaacggtcaaagcaggggacaccatcagactggaggcaggggtgagaggcaaacctt
tcccggaagttgcctggaccaaagacaaagatgctgcagatttaacaaagtcaccaaggg
tcaagattgacaccagtgccgagtcctcgaaattctccctcaccaaagcaaggcggagcg
atggtggcaaatatgtggtcacagccactaacacagccggcagttttgtggcctatgcta
cagtcatcgttttagataagcctggtcctgtaagaaacctgaaaatcactgatgtgtcca
gcgacaggtgtactctccgctgggatccaccagaagatgatggtggctgcgaaatacaaa
attatattctagaaaaatgtgagagcaagagaatggtgtggtctacctattctgctaatg
tcttgacgccaggtgccacagtgactcgtctcatagaaggaaacgaatacatttttagag
tccgtgcagaaaacaaaataggcacaggacctccaacagaaagtaaaccagtcatcgcaa
agaccaagtatgacagacccggccgccctgacccgccagaggtcactaaagtaagcaaag
aagagatgactgtggtctggaacgcccccgaatacgatggagggaagtctatcacagggt
actatttggagagaaaagaaaagcatgcagtccgctgggtccctgtgaacaagagtgcca
tccccgagcgacgcatgaaagtacagaatctcctcccagggcatgagtaccagttccgtg
tcaaggcagaaaatgaagttggcattggagaaccaagcttaccatcaagaccagtggtgg
caaaagatcccatagaaccgcctggtccaccaaccaatttcaaagtggtcgatacaagca
aacattccatcactctcgcatggggaaagccagtctatgatggcggtgcaccaataattg
ggtatgttgtcgaaatgagacccaaaaaggcagatgcctcacctgatgagggctggaaga
ggtgcaatgctgcggcccagcttgttcgtatggaattcacggtcaccagtttggatgaga
accaggaatatgagttcagggtgtgtgcccaaaaccaggttggcatcgggcgccctgcag
aactgaaggaagccatcaaacccaaggaaatcctagagcctccagagattgacttggatg
ccagcatgagaaaactggtcgtagtgagagcaggctgcccaattcgactatttgcaatag
tgagaggacgacccgcccccaaggtcacatggcgcaaagtgggtattgataatgtggtca
gaagaggacaagttgatctagttgacaccatggccttccttgtcatccccaattccaccc
gggatgattctggaaaatactccttgacccttgtgaacccagcaggagaaaaggccgttt
ttgtgaatgtcaaagtactagatacacctggacctgtgtctgatttaaaagtctctgatg
tcactaaaacatcatgccatgtgtcctggggccctccggaaaatgatggtgggagccaag
tgacacattatatcgtggagaaacgtgaggcagaaagaaaaacatggtcgacggttaccc
ctgaagtgaagaaaacaagcttcaatgtaaccaaccttgttcctggaaacgaatatttct
tccgagtaaccgctgtgaatgaatatggccctggtgtcccaacagacatccccaaacctg
tgcttgcatcagatcctctcagtgagccagatcctccaagaaaacttgaagtgacggaaa
tgaccaagaacagtgcgacactggcctggttacctccattgcgtgatgggggtgctaaaa
ttgacggctatatcatcagttacagagaagaagaccagcctgcagatcgctggacagagt
actcggtggtcaaagacctcagccttgttgtcactggcctaaaggaaggaaagaaatata
aatttagggttgcagctagaaatgctgttggagtcagcttgccaagagaggccgaaggtg
tctatgaagccaaagaacagctgttgccaccaaagatcctcatgcccgagcaaatcacta
ttaaggctgggaagaaactccgagttgaagctcatgtgtacgggaagcctaaccccatct
gtaaatggaagaaaggagatgatgacgttgtcacgtccagccacctggccatccataaag
gagacaactcctcagttctgatcataaaagatgtcaccaggaaagacagtggttactata
gcctcacagcagagaacagctccgggacagacacccagaaaatcaaagtaatcgtcatgg
atgctcctggccccccgcagcctccatttgacattgctgacatagatgctgatgcttgct
ccctatcttggcacatccctcttgaagatggaggcagtaacatcaccaattacatagtag
agaaatgcgatgtaagccgtggggactgggtcacagctctagcatcagtcaccaagactt
cctgcagggttggaaagctgatccctggccaggagtatatcttccgggtccgtgctgaaa
acagatttggcatttcagagcctctcacatctccaaagatgcttgctaagttcccatttg
atgttcctagtgagccaaagaatgcacgggtcacaaaagtcaacaaagactgcatatttg
tgaaatgggacagaccagacagtgatggaggaagccccatcactggttacctgattgaac
gcaaagaaagaaacagtttgctctgggtaaaagctaatgacacggttgtccggtcaactg
agtatccttgtgctggcctcgtagaaggtctagaatattccttcagaatctatgccctaa
acaaagctggatccagtccgcctagcaaaccaacagaatatgtaactgcaaggatgccag
tggatcccccagggaaacctgaagttgttgatgtcaccaaaaatactgcatcccttatct
gggcccgtccaaaacatgatggaggcagcaaaattattggctattttgtagaagcttgca
agctccctggtgataagtgggttcggtgcaataccacacctcaccaggttcccctggaag
agtacacggctacggggttagaagagaatgctcagtatcagtttagagcaattgcaaaga
ctgctgtgaacatcagccagccttctgagccttctgacccggtgaccattcttgcagaaa
atgttcctccaaggatagaactcagtgtcgaaatgaagtctttgcttaccgtgaaagctg
ggactaatgtctgcttggacgctactgtctttggtaaaccaatgccaacagtttcttgga
agaaagatggcacaccaataaaaccagccgaaggcataaagatggcaatgaagcggaact
tgtgtaccttggagctattcagtgtgaaccggaaggactctggagactataccatcactg
ccgaaaattccagtggttccaaatcagccaccattaagcttaaagtactagataaaccag
gtcctccggcctctgtcaaaatcaacaagatgtacgcagaccgggcaatgctgtcttggg
agcctcccctcgaggacggaggctcagaaatcaccaactacatcatcgacaagcgtgaaa
caagcaggcccaactgggctcaggtgtctgctactgtgcccatcaccagctgcaccgtgg
agaaactcatagagggccacgaataccagttccgtatatgtgctgaaaataaatacggag
tgggcgatcccatcttcactgagccagcaattgctaaaaacccatatgacccacccggac
gccctgaccctccagtcattagcaacgtcacaaaagatcacatgacagtcagctggaaag
ccccagctgatgatggcggctcacctatcactggatacttggttgaaaagcgggaaactc
aggcagttaactggacgaaagtcaacagaaagcctgtcatagaaagaacgttaaaagcaa
cgggtctccaggaaggcactgagtatgaattccgagttactgctataaataaagctggac
ctggcaagcccagtgatgcatccaaagctgtgtacgctcaggacccgctgtatcctcctg
gtccaccagctttcccaaaagtatacgacaccacccgcagctctgtgagtctgtcctggg
gcaagccagcctatgatggtggtagccccatcatcggttacctcgtggaagtaaagcgag
cggactctgaccactgggtgcggtgcaatttaccagagaagctccagaaaacccgctttg
aggtgactggcctgatggaaaatacggagtatcagttccgtgtctatgctgttaacaaga
tcgggtacagcgacccaagtgacgtgcccgataaacactgtcccaaggacatcctaattc
cccctgagggagagcttgatgctgaattaaggaagacacttattttacgggctggggtta
ccatgagactgtacgtgcccgtcaaaggacgcccacctccgaagattacttggtctaaac
caaatgtcaatctgagagaacggattggactggacataaagtcaactgactttgacactt
tcttgcgctgtgaaaacgtgaacaaatacgatgcaggaaagtacgtcttaaccttggaga
acagctgtgggagaaaggagtacacgattgtagtgaaagtactcgacactcctggaccac
ctgtcaatgtgaaggttaaggaggtatccaaggactctgcatacatcacctgggatccac
ccgttatcgacggtggaagccccatcataaactacgtggttgagaaacgggacgcggaga
ggaagtcgtggtcgacagtgacaactgagtgttcaaaaacaagcttcagagtctctaact
tggaggaggggaagtcctacttcttcagggtgttcgctgaaaatgagtatggcatcggtg
atccgggcgaaacacgggatgctgtcaaagcttccgaaacccctggacctgttgtcgacc
tgaaagcactggctgtcactaagtcatcctgtaccattggctggaaaaagccacgcactg
acgggggaagccgaatcactggctatgtggtggatttcctgacagaagaaaataagtggc
aacgggttatgaaatcactgagcctacaatactccacaaaagatctgaaggaagggaaag
agtacacctttagagtgagcgctgaaaatgaaaatggagagggaaccccaagtgaagtca
gtgtggtggccaaggacgatgtcgtggctcctgatcttgacttaaaggatctacctgact
tgtgctacttggctaaagaaaatagcaacttccgtcttaagatccccataaagggcaagc
cagcaccatcggtgtcttggaagaaaggggaagaccctctagcaactgacacaagagtca
gtgtcgagtcaactgcagttaatacaacccttgtggtgtatgactgccaaaaatccgatg
ctggaaagtacacaatcacactcaagaacgttgctggcaccaaggaaggaaccctctcta
taaaggtcgttggcaagcctggtatccccactggaccaatcaagtttgatgaagtcacgg
cagaagccatgacgctgaagtggggtcctccaaaggacgatggggggtctgagattacca
actatgtgctagagaagagagactctgtgaataacaagtgggtgacatgcgcctcggctg
tccagaaaaccacctttagagtaacgaggctccacgagggcgtggagtacaccttcaggg
tcagcgcggaaaataaatatggcgtaggagaaggcctcaagtcagagccaattgttgcca
aacatccatttgatgtgccagatgctcccccaccccccaatattgtggatgtcagacatg
attcagtatctctaacatggactgaccccaagaagaccggaggctcaccaattacagggt
atcatattgaattcaaggaaagaaacagccttctatggaagagagctaacaagactccta
taaggatgagagatttcaaagtgacaggattaactgaaggtcttgaatatgagttccgag
ttatggctatcaatctcgcaggagtgggcaagccaagcctgccgtcagagccggttgtgg
cactcgatccaatcgatcctcctgggaaacctgaagttattagtgtcacaaggaattcag
tgactctcatctggacagaacccaagtatgacggtggtcataaactgacagggtacatcg
tggagaagcgggatctaccctctaagtcttggatgaaagccaatcatgttaacgttccgg
actgtgcctttactgtaactgacctcgttgaaggtggaaaatatgaattcagaatcagag
caaagaatacagcaggtgccatcagcgctccgtcagagagcacaggaactattatatgca
aggatgaatacgaggcaccgaccattgtccttgatcccacgattaaagatgggctaacag
ttaaagcaggggataccattgttttaaatgccattagcattcttggcaagccccttccaa
agtcaagttggtccaaggcaggaaaagatatcagaccatcagacatagctcaaataacct
caaccccgacatcctccatgttgacagtcaagtatgccacaagaaaggatgccggcgaat
acaccatcactgctaccaatccttttggcaccaaggaggaacatgtgaaggtatccgtcc
ttgatgtacctggcccaccaggtcccattgaaatcagtaatgtttctgctgaaaaagcaa
cactgacctggacgcctcccttggaagatggaggatcaccgattaaggcctacgttcttg
aaaagagggaaaccagtcggcttttgtggacagtggtttctgaagacattcaggcttgca
ggcatgtagtgaccaaactcatccaaggaaatgaatacctcttccgagtgtctgcggtta
accattatggcaaaggagaacctgttcagtcggagcctgtcaaaatggtcgacagatttg
gtccccctggccctcctggaaaaccagagatctcaaacgtcaccaagaacaccgccacgg
tcagctggaagagaccgactgatgatggaggcagtgagatcacagggtaccacatagaaa
ggagagagaagaagggcttgcgctgggtgagagcaacaaaaactccagtttccgatcttc
ggtgcaaagtcactggactgcaagaaggaaatacgtacgaattccgtgtcagtgcagaaa
acagagcagggattggtccacctagtgacgcctcaaatcttgttctgatgaaagatgcag
catatcctccaggaccaccttcaaatgcgcatgtcactgacactaccaagaaatcagctt
cgttagcatggggcaagcctcattatgacggcgggcttgaaatcactggctacgtggtag
agcatcagaaagtaggagatgatgcctggataaaagacacaacgggaacagctctcagga
tcactcagtttgttgttcctgaccttcagactaaagaaaagtacaacttcagaattagtg
ccatcaatgatgcaggtgttggggagccagcggtgattccaaacatcgagattgtagaga
aagaaatggctcccgatttcgagctggatgccgagcttcgaagaacacttgtggttaggg
caggactcagtattaggatttttgtaccaattaaaggtcgtcctgcacctgaagtgacat
ggaccaaagataatgtcaacctgaagcaccgagccaacatcgaaaacacggagtctttca
cccttctcattatcccagagtgtaacaggtatgacacgggtaagttcgtgatgaccattg
aaaacccagctgggaagaagagtggcttcgtcaatgtccgggtcctagacaccccaggtc
ctgtccttaacctgaggcctacagacatcaccaaggacagtgtcacccttcactgggacc
tccctctcatagatgggggctcacgtatcacaaactatattgtggagaaacgtgaagcca
cacggaagtcatactccactgtcaccactaagtgccacaagtgtacgtataaagtaactg
gcctgacggaaggctgcgaatacttcttcagagtgatggcagaaaatgaatacggggttg
gtgagccaacagaaactacggagcctgtaagagcctctgaagccccgttacccccggaca
gccttaacattatggacataaccaagagcactgtcagcctggcctggcccaaacccaggc
atgatggcggcagcaagatcactggctatgtgattgaagcacagaggaaaggatctgacc
agtggacccacatctcgaccgtgaaagggttagaatacgtggtgaagaaccttactgaag
gagaggagtataccttccaggtgatggcagtaaacagcgcaggcagaagtgcccccagag
aaagcagacctgtcatcgtcagggagcagacaatgcttccagagctggatctccggggca
tctatcagaagctggtcattgccagagctggggacaacatcaaagttgaaattcccgtac
ttggtcggcccaagcctacagttacatggagaaaaggagaccaagttctcagacagacac
agagagtgaatgttgagaacacagcagcgtcaaccaccttaaatatcagcgagtgtgtcc
gcagtgacagtggcccctatccactgacggcaaggaacactgtgggagaggtcggtgagg
tcataaccgttcaagtccatgatatcccaggaccgcctacaggaccaatcaaatttgatg
aagtttcatcggactttgtaaccttctcttgggagccacctgagaatgatggaggtgtac
caataagcaactatgtggtagaaatgcgtcagacagatagtaccacgtgggcagagttag
caacgactgttatacgcactacctacaaagccactcgcctgactacgggggtggagtatc
agttccgcgtaagagctcaaaacagatatggagttggtcccggtatcacatctgcatcta
tagttgctaactatccatttaaggtgcctgggcctcctggcacccctcaggttactgcag
tcaccaaagactcaatgacaattagctggcacgagccactttctgatggtggaagcccca
ttttaggataccacattgaaaggaaagaacgaaatggcattctctggcagacggtgagca
aagcactagtcccgggcaacattttcaaatcgactggacttaccgatggcattgcttatg
aattccgagtgattgcagaaaacatggccggcaagagcaagccaagcaagccatccgaac
cgacgtttgctctggatcccattgacccacctgggaaaccagtacctctaaacatcacga
gacacacagtgactctgaagtgggctaagcccgagtatactggcggctttaaaattacta
gttatgtggttgaaaagagggaccttcccaatggacgatggctgaaggccaacttcagca
acattttagagaacgaatttacagtcagtggcctgactgaagatgccgcgtatgagttcc
gtgtgattgccaaaaatgctgctggtgccattagtccaccatctgagccatcagatgcca
tcacatgcagggacgatcttgaagcaccaagaataatggtggatgtgaaattcaaggata
ccatcacgttgaaagctggggaagcgttcaagctggaagctgacgtttcaggccgcccac
cgccaacaatggaatggactaaagactcaaaggagcttgaaggcacagggaaattagaaa
taaaaattgcagacttctctactcatctgataaacaaggattcttcaagaacggacagtg
gggcttacatcctgacagcaactaatcctggtggctttgccaaacacattttcaacgtca
aagttcttgatagaccaggcccacctgaaggacctttagctgtgtctgatgtgacatcag
agaagtgtgtgctgtcatggttacctccactggatgatgggggtgccaaaattgatcact
acatagtacagaaacgggaaactagcaggttggcatggacaaacgttgccaccgaagtcc
aggtaacaaagctgaaggtcacgaagctcctgaaaggcaatgaatacatattccgtgtca
tggctgtaaataaatacggggttggagagccactagagtcagagcctgtgcttgctgtgg
atccctatggaccaccggatccacccaagaaccctgaagttacaaccatcaccaaagact
ccatggttgtctgctggggacaccctgactctgatggaggaagtgagatcatcaattaca
ttgtggagcgccgtgataaagctggccaacgctgggtgaaatgtaacaaaaagactctga
ctgacttaagatacaaagtgtctggcctgacagaaggacatgaatacgagttcagaatta
tggcagaaaacgcagctggaatgagtgcgcccagtgccaccagcccgttttataaagctt
gcgacactgtgtttaaacctggcccaccgggtaacccacgcgtccttgacacaagtaggt
cctccatttcgattgcatggaataaacctatctatgatggaggttcggaaatcactggtt
acatggttgagattgccctgcctgaagaagatgagtggcaggttgtcactccaccagctg
ggctcaaggcaacatcctataccatcaccaacctcatcgagaaccaggaatataaaatcc
gcatctacgccatgaattctgaagggcttggggaacctgcccttgtacctggcactccca
aggcagaagaaagaatgctgcctccagagattgaactggatgcggacttacgcaaagtcg
ttattataagagcctgctgcaccctgagactctttgttcccatcaaaggaagaccagcac
ctgaggtcaagtggacccgagagcacggagaatctctggataaggccagcattgaatcca
caagttcttacaccctgcttatcgttggaaatgttaacagattcgacagcggcaaataca
ttctaactgtagaaaacagctcaggcagcaagtccgcatttgtcaatgttagagtgctgg
atacaccaggccctccacaaaatctcaagataaaggaggtcacgaagacatctgtcacgt
tgacgtgggagcctcctctccttgacggtggctcaaaaataaagaactacattgttgaaa
agcgagagtcgacaagaaaggcttattcaacagtggcaacaaactgccataagacttcct
ggaaggtagaccagcttcaagaaggctgtagttactacttccgggttcttgctgaaaatg
agtatggcatcggactgcctgctgaaacagcagagtctgtaaaagcatcagaacgacctc
ttccgccggggaaaatcactttgatggacgtcacaagaaacagtgtgtctctgtcttggg
agaagccagaacatgatggaggcagccgcattctaggctacattgtagagatgcagagca
aaggcagcgacaaatgggccacatgtgccacagtgaaagtcacagaagctaccatcactg
gcttgatccagggtgaggaatattctttccgtgtttcagctcagaacgaaaagggcatca
gtgaccccagacaactgagtgtgccagtaattgctaaagacctggtgattccaccagcct
tcaaactcctctttaacacattcaccgtgctggcaggtgaggacctgaaaattgatgtac
cgttcatcggacgccctacaccagctgtcacctggcataaagatgatgtgccgctgaagc
aaacaactagagtaaacgcagagagcacagagaacaattccttgctgaccatcaaggagg
cctgccgagaagatgttgggcattacacagttaaactgaccaactcagcaggcgaagcta
ccgaaacccttaatgttattgttcttgacaaaccaggacctccaactggaccagttaaaa
tagatgaggtgacagccgacagtgttactctctcctgggaaccaccaaaatatgacggag
gaagctccatcaataactacatcgtagagaaacgggacacgtccaccaccacctggcaga
ttgtgtcagctacggttgcaaggacaaccataaaggcctgcaggctaaagactggctgtg
aatatcagttcagaatcgctgccgaaaatagatacgggaagagcacctacctcaattcag
agcctgttattgcccagtacccattcaaagtgccaggtccgcctggcacaccttttgtca
cacttgcctccaaagacagcatggaagtacagtggcatgagccagtcagtgatggtggga
gcagagtcgttggctatcatctagagcgcaaggaaagaaacagcatcctctgggtcaagc
taaataaaacacctatccctcaaaccaagttcaagacaactggccttgaagaaggcattg
aatatgaattccgagtgtctgcagagaacattgtaggcatcggcaagccaagcaaaccat
cagaatgttacgtagctcgtgacccgtgcgatccaccaggtcggccagaggcaattgttg
tcacaaggaactctgtgactcttcagtggaagaaacccacctacgatggtggaagcaaga
tcactggttatgttgtcgagaagaaagaattgcctgatggccgctggatgaaagccagtt
ttacaaatatcattgacacccagtttgaggtatctggcctaattgaagatcacaggtatg
agttccgggttatagctcgaaatgctgcaggagtgttcagcgagccctcagaaagcactg
gggcaataacagcgagggatgaggtggagccaccgaagataagcatggaccccaaataca
aagacacggttgtgatccatgccggtgagtcattcagggtcgatgcggatatatatggca
aaccaataccaaccactcagtgggtaaaaggtgaccaggagctttcaagcacagctcggc
tagaaataaagagcactgactttgccaccagtctcagtgtcaaagatgcagtacgtgtcg
acagtggcagttacatcctgaaggccaaaaacgttgcaggggagagatcagttaccatca
acgtcaaagttcttgataggccagggccacctgagggacctgtcgctatatcaggggtta
cagcagaaaaatgtacactagcttggaaacccccacttcaggatggtgggagcgatatca
caaattatattgtggaaagacgagaaaccagccgcttagtctggactctggttgatgcca
atgtgcaaactctcagctgcaaagttatgaagcttcttgaaggcaatgaatatattttcc
gtataatggctgtgaacaagtacggtgttggtgaacctcttgaatctgagccattaattg
ccaagaatccatttgtagtcccagatgcacccaaagctccagaaattacagctgtgacca
aagactcgatgattgtagtgtgggaaaggccagcatctgatggtggcagtgagattctag
gatacgttctggagaaacgagacaaagaaggcatcagatggacaagatgccacaagcgtc
taattggagagctgcgcctgagagtaactggactcctagaaaatcacaattatgaattca
gagtctcggctgaaaacgctgctgggctcagtgaaccaagccccccttctgcctaccaaa
aggcttgtgaccccatttacaaaccaggccctccaaacaaccccaaagtcatggatgtta
ccagatcttcagtgttcctttcttggagcaagcctatctatgatggtggctgtgaaatcc
aaggatacattgtagaaaaatgtgacgtgagtgttggtgaatggacaatgtgtacgccac
caactggaatcaacaagacgaacctagaagtggagaagctgttggagaagcacgaataca
acttccgggtctgcgccattaacaaagctggagttggcgagcatgctgacgtccctggac
ctgtaaaggttgaagaaaaacttgaagccccagatgtggatcttgaccttgaactaagga
aggttattaatatcagagcaggtggttccttacggttgtttgttcctatcaaaggtcgtc
ctacaccggaagttaagtgggggaaggcagatggtgaaatccgagacgcagctattattg
atgtcactagcagcttcacgtctcttgttcttgacaatgtcaatcgatacgatagtggga
aatacaccctcaccttagaaaacagcagcggaacaaaatctgcctttgtgacagtgaggg
tcctcgacacgccaagcccacctgttaacctgaaggccacagaaatcaccaaagactcag
tatcaattacatgggaacctcctctgttggatggaggatcaaaaattaaaaattatattg
ttgagaaacgagaagccacaagaaaatcatacgctgcagttgtaacaaactgccataaga
attcttggaaaattgaccagcttcaagaaggctgcagttactacttcagggttacggctg
agaatgaatatggtattggccttccagcccgcacagcagatccaatcaaagtggcggaag
tcccacaacctccagggaaaataactgtggatgatgtcaccagaaacagtgtctctctga
gttggacaaagcctgaacatgatggtggcagtaaagtcattcagtatattgtagaaatgc
aagctaaaaacactgacaggtggtcagagtgtgctagggtgaagtctcttgaagctgtta
ttaccaacctaactcagggagaagaatatctctttagagttattgctgtaaatgaaaaag
gaagaagtgaccccagatcccttgcagttccaattattgccaaagatctggtcatcgagc
cagacgtaagaccatcattcagcagttatagtatacaggttggccaagatttgaaaatag
aagtgccaatttctggacgtcctaaaccaaccatttcctggaccaaagatggggtgccac
tgaaacagaccacaagagtcaatgttactgactcccttgacctcaccacactcagtatta
aagaagctcataaggacgatggtggacagtatggaatcacagttgccaatgttgttggtc
agaaaacagcagccattgaaatcataactctggataaacctgatcctccaaaggggcctg
tcaaatttgacgaagtcagtgctgagagtattacattatcctggaaccctcccttatata
cagggggctgccaaattaccaattacattgttcagaaaagagatacaaccacaacagtat
gggatgtcgtctctgctactgttgccagaactacactcaaagtaaccaaactgaaaacag
gtacagagtaccaattcagaatatttgctgaaaaccgatatggacaaagctttgctttgg
agtctgaaccaattgtagctcaatatccctacaaagaaccaggccctccaggaacgccat
ttgccacagccatctccaaagactctatggttgtgcaatggcatgaaccaatcaacaatg
gtgggagcccagtcataggttaccaccttgagagaaaggaaaggaatagcattctgtgga
cgaaagtcaacaaaaccattattcacgacacccagtttaaagcactgaacctcgaagaag
gcattgagtatgaatttagagtttatgccgaaaacattgttggtgtaggcaaggcgagca
agaattctgaatgctacgtagccagagacccctgtgacccgccaggaacgccagaagcag
taatagttaaaagaaatgaaatcactttacagtggaccaaacctgtgtatgatggtggca
gtatgatcacagggtacatcgtggagaaacgggatttacccgagggtcgctggatgaaag
ccagcttcaccaacgtcattgaaacccagttcaccgtgtcgggtctcactgaggatcaaa
gatacgaattcagagtcattgcaaagaatgcagctggtgcaataagcaagccctctgaca
gtactggaccagtaactgccaaggatgaggttgaactcccacgaatttcaatggatccaa
aattcagagacacaatagtggtaaatgctggagaaacattcagacttgaggctgatgtcc
acggaaagcccctacccaccattgagtggttacgaggagataaggagattgaagaatcgg
ctagatgtgagataaagaacacagatttcaaagctttacttattgtaaaagatgccattc
gaattgacggtggacagtatattttgcgagcctctaatgtggccggttctaagtcattcc
cagtgaacgtgaaagtactagacagaccagggcctccagaagggccagttcaggtcactg
gagtcacgtctgaaaaatgcactttggcgtggtctccaccacttcaagatggtggcagtg
acatttctcactatgttgttgaaaagcgggaaactagtcgactcgcatggactgtggttg
cttcagaagttgtgacgaattctctgaaagttaccaagctcttagaagggaatgaatata
tcttccgaataatggctgtcaacaagtacggtgttggagaacctttggaatctgcaccag
tactcatgaagaatccttttgtgcttcctggaccaccaaagagcttggaagtcacaaaca
ttgccaaagactccatgacagtgtgctggaatcggccagacagtgatggtgggagtgaga
tcattggttacattgtggagaagagagacagaagtggcattcggtggataaagtgcaaca
agcgccgcattacagatttgcggctcagggtcacggggctaacagaagagcacgaatacg
aattcagagtctctgcagaaaatgctgctggagttggagaaccgagtccagccaccattt
actacaaggcttgtgatcctgtgttcaaacctggcccacccaccaatgcacacattgtag
acaccactaaaaattcaattacacttgcctggagcaagcccatctacgacgggggcagtg
agatcctgggctacgtcgtagaaatctgtcgagcagatgaagaggaatggcaaatagtta
ctccacagactggcctgagagtcactcgatttgaaatctccaaactcactgaacaccaag
aatataaaatacgagtctgtgccctcaacaaagttggtttaggtgaggccgcagcagttc
ctggtaccgtgaaaccagaagataaacttgaggcacctgaacttgaccttgactctgagc
tgaggaaaggaattgttgtgagagctggtggatctgccagaatccatattccattcaaag
gtcgtccaacacctgagatcacctggtcaaaagaggaaggtgaattcacagataaggtcc
aaattgagaagggagtgaacttcacccaactctcaatagataactgtgacaggaatgatg
ctgggaaatacattctcaagttggagaacagcagcgggtcgaagtcagcttttgtaactg
tgaaagtacttgacacgccaggacccccgcagaatttggctgtcaaggaagtgagaaaag
actctgttcttctggtatgggaaccgcctatcattgacggtggggcaaaggtcaagaact
atgtcattgacaagcgggagtcaaccagaaaagcatatgctaatgtgagtagcaagtgca
gtaaaacaagctttaaagttgagaatctgactgagggagccatctattactttagagtca
tggctgagaatgaatttggagttggtgttcccgtggaaacctccgatgccgtgaaagctt
ctgaacctccttccccaccaggaaaggtagcactcaccgacgtgtcccaaaccagcgcat
cacttatgtgggagaaacctgaacacgatggtgggagcagaatcctggggtatgttgttg
agatgcagcccaaaggaacagaaaaatggagtgtagtggctgaatccaaagtctgtaatg
cagttgttactggcctgagctccggacaagaatatcagttccgtgtcaaagcttacaatg
agaaaggaaaaagtgacccgagagtgctcggtgttcctgtcatagccaaagatttgacta
tccagcctagttttaagctgccatttaacacgtacagtgtccaagcaggagaggatctga
aaatagaaatcccagtcataggccgaccaagacctaaaatttcttgggtcaaagatggtg
agcctcttaaacagaccacaagagtaaatgttgaagaaacagctacttcgactattttac
acattaaagaaagcagcaaagatgactttggaaaatacagtgtcacagcaacgaacagtg
caggcaccgcaacagaaaacctcagcattattgttttagaaaagcctggccctccggttg
gaccagtgaagtttgatgaagtgagtgcagactttgtggtcatctcttgggaacctccag
cctatactggaggatgtcaaataagcaactacatcgtagagaagcgagataccacgacca
ccaactggcagatggtatcagcgacagttgccagaaccaccattaaaataagcaaactga
aaaccggcactgaataccagtttaggatttttgctgagaacaggtatggaaaaagtgctc
ccttggattctaaacccgttcttgtacagtatccatttaaagaacctggaccgcctggaa
ccccatttgtgacatctgtctcaaaagaccaaatgctggtgcagtggcatgagccagtta
gtgatggcggcagcaaagttactggctaccatcttgagcagaaggaaaagaatagcatcc
tgtgggtcaagttgaataagacccccatccaggacaccaaattcaaaacagtggggcttg
atgaaggacttgaatacgagttcagggtttccgctgagaacattgtgggcatcggcaagc
ctagcaaagtgtcagagtgctacgtagcacgcgacccatgtgatccacctggccgccccg
aagccatcgtcattacaaggaacagtgtcacactgaaatggaagaaacctgcttatgatg
gtggcagcaagatcacaggttatatcgtagaaaagaaggatctaccagaaggccggtgga
tgaaagccagcttcaccaatgttgtggagactgagtttacagtttccgggcttgtagaag
accaaagatatgaatttagagtaattgcgagaaacgcagctggcaacttcagtgagccat
ctgaaagcagtggtgcgatcactgcaagggacgaaattgacgcaccaaatgcctcactgg
accctaaatacagagatgtcatcgttgttcatgcaggagagacctttgtcctcgaagctg
atatccgtggcaaacccataccggatattgtttggtcaaaagatggcaacgaactcgagg
aaacagcagccaggatggaaattaaatccactctccagaagacgactctcattgtcaagg
actgcatccgtacggatggaggccagtacaccttgaaactcagcaatgtcggcggcacca
agactatacccatcactgtaaaagtactggataggccagggcctcccgaaggacctctga
gagtgactggagttacagctgagaagtgttacctggcatggaacccacctttgcaagacg
gcggtgctagcatttcacattacatcattgaaaagagagaaacaagcagactctcctgga
cccaggtctcaactgaagtgcaggcccttaactacaaagtcacaaagttacttcctggga
acgagtacattttccgggttatggcggtaaataaatacggaatcggagaacccctggagt
ctgagcctgtgatagcctgtaatccttacaagcttccagggcccccttctacacctgagg
cctcagcaatcaccaaagactcgatggtactgacgtggacacggccagtggacgatggcg
gtgctgaaatcgaggggtatgttcttgaaaagcgagacaaggaaggcattagatggacca
agtgcaacaagaaaacgctaacagaccttcggttccgggtgaccggcctcacagaaggcc
attcctatgaattcagagttgctgctgagaatgcagctggtgtcggggaacccagcgagc
catcagttttctaccgtgcctgtgacgccttgtatccgccaggtccaccaagcaacccca
aagtgacagacacttccagatcttccgtctccctagcgtggaataagccaatttacgatg
gcggtgcacctgtgaggggctatgtgattgagttcaaagaagctgctgctgacgagtgga
cgacctgcaccccaccgtcgggattacaaggtaaacagttcaccgtgacccagcttaaag
agaacactgagtacaacttccgcatctgcgctttcaatacggaaggtgtcggggaacctg
caaccatacctggctctgtcgtggctcaggagaggatggaagcaccagaaatagaactcg
atgcagatctcagaaaggtggtgactctgcgagcaagcgccaccttgcgcctgtttgtca
cgatcaaaggccggccagaacctgaagttaagtgggagaaggccgaaggcgttctcacag
agagggcccagattgaggtgaccagttcctacacaatgctggtgattgacaacgtgacca
ggtttgacagcggtagatacaacctcaccctggagaacaacagtggctccaaaacggctt
ttgtcaacgtcagggttcttgactcgcccagtgcccctgtgaacctaactgtcagagaag
tgaagaaagactcagtgacactggcctgggagccaccacttattgatggcggcgcaaaga
ttacaaattacatcgttgaaaaacgagagacgacaaggaaagcttacgctaccattacaa
acaactgcaccaagagtgctttcaaaatcgaaaacctacaagaagggtgctcttactact
tccgagtcctggccgccaacgaatatgggattggtttgccggctgaaacagcggaacccg
tgaaagtgtctgaaccaccgctcccacccggaagggtaacccttgtggatgtgacccgta
gcacggctacgcttaagtgggagaaaccagaaagcgatggtggcagcaagatcactggtt
atgtggtggaaatgcagacaaaaggcagtgaaaagtggagcacgtgcacacaagtgaaga
ccctggaggcaactgtatctgggctcactgcaggagaagagtatgtcttcagagtagctg
cagttaatgaaaaaggaagaagtgatccaagacagctcggggtgccagtcatcgcaaaag
acatcgagataaagccttcggtggagctccctttcagtactttcaacgttaaggctaatg
accaactcaaaattgacataccattcaaaggaaggcctcaagctaccgtggcctggaaaa
aagacggacaggtcctcagagagacaaccagagtcaacgtgtcttcctccaagactgtaa
cgacactgtctattaaagaagcttccagggaggatgttggaacttatgaactgtgcgttt
caaatactgctggatccattacagttcccatcactgtcattgtccttgacaggcctggac
ctccaggacctatccgtattgatgaagtgagctgtgacaatgtgtctatttcttggaatc
ctccagaatacgatggtggctgccaaattagcaactacattgttgaaaagagagaaacca
cgtctacaacatggcaggtagtctcacaagccgtggcaagaacatccattaaaatagtcc
gcctggtaacaggaagtgagtatcagttccgcgtttgcgcagagaatcgatatggaaaga
gttcctacagtgagtcctcggctgttgttgccgagtatccattcagccccccagggcctc
ctggtactcctaaagttgtgcatgccacaaagtctacgatggttgtaagctggcagatac
cagttaatgatggaggaagccaagtactcggctatcacctcgaatacaaagaaagaagca
gcattctctggtcgaaggcaaacaaagtcctcatcgcagacacacagatgaaggtgtccg
gtctggatgaagggctcatgtatgagtaccgtgtatacgcggagaatattgctggaattg
gtaaatgcagcaaggcatgcgagccagtcgccgcaagagacccttgtgaccctcccggac
aacctgaagtcaccaacatcaccagaaaatcagtgtccctgaagtggtctaaaccacgtt
atgacggtggagctaagatcaccgggtacactgttgaacgcagggagctacccgacggca
ggtggctgaagtgcaacttcacaaacgtgcaggaaacgtactttgaagtaacggagctaa
ctgaagaccagcgttacgagttccgggtttttgcgagaaatgccgccgactctgtcagtg
agccatccgaatccactggtcccattaccgtgaaagatgatgtcgaggcaccgagaatta
tgatggatgtcaaattccgagacgtcattgttgtcaaagctggagaagtcctcaagataa
atgcggacattgcggggagacctctgccagtgatttcctgggccaaagatggggtagaaa
ttgaagaaagggcaaaaacagaaattgtctcgacagatagtaataccacgttaacagtta
aagactgtgtgagacgagattctgggcagtacgtgcttacactgaagaatgttgcaggaa
ctcggactatggcagttaactgtaaagtactcgataagcctggcccaccagcaggcccac
ttgaaataaacggcctcactgctgaaaagtgctctctttcctggggccgtccccaggaag
atggcggtgcagacattgattattacattgtggaaaagcgtgaaacgagccgcctcgcgt
ggaccatatgtgaagcagagttgaggacaacatcttgtaaagtgaccaagctactcaaag
gcaatgaatacatctttagagtaaccggtgttaataagtatggtgtcggggagcccttgg
agagtgtggccgtgagggcactagatccgttcaccatccctagtccacccacatctttgg
agattacatctgtgaccaaagattccatgacactttgctggtcaagacctgagaccgatg
gcggcagtgatatctctggctacgtaatcgaaagacgtgagaaaaacagcctacggtgga
tacgtgtgaacaaaaaaccagtttatgatctgagagtgaagtcaacaggactccgggaag
gatgtgaatatgagtatcgcgtttttgcagaaaacgccgctggcctaagccttccgagtg
aaacttctcccttagttcgggcagaagatccagtgttcttgccgtctcctccatccaaac
ccaaaattgtagactctggaaagacaaccattaccatcagttgggttaagcctttgttcg
acggtggggctccaataaccggctatactgtagaatacaaaaagtctgatgaaactgact
ggagagctgccattcagagcttcagaggcaccgaatacacaatgagtgggctaacgacag
gggctgagtacgttttcagagtgaggtctgtcaataaggttggggccagtgaccccagcg
atagctccgacccacaggtagcaaaagaaagagaagaagaacctgtatttgatgttgaca
gtgaaatgaggaagactttgattgtcaaggctggctcctcctttaccatgacagttcctt
tcagaggaagaccagtacccaacgtctcctggagtaagccagacactgacctccgcacca
gagcatacatcgattccacagattctcggacattgcttacgattgaaaatgccaacagaa
ccgattctggaaaatacacactgacgatccagaatgttttgagtgctgcctccatgacct
tcgttgtcaaagttttagattccccgggtcctccatccaatatcactgtacgtgaagtaa
caaaggagacggctgtgctgtcctgggacgtccccgagaacgatggtggggcaccagtga
agaattaccacatagaaaagcgcgaggccagcaagaaggcatgggtgtctgtcaccaaca
actgcaaccgcctctcttacaaagtgaccaacttacaagaaggagctatttactacttca
gagtcgctggagaaaacgagtttggtgttggtgtgccagccgaaacaaaggaaggagtta
aaataacagaaaaaccaagcccaccagaaaagcttggagtaacgagtgtgtccaaagaca
gcgtctccctgagctggttgaagccagaacatgatggcggaagcagagttgtacactatg
ttgttgaagcactagaaaaagggcagaaaaactgggttaagtgtgcagtggtgaagacaa
cccatcatgttgtttctgggctgagagagaatcatgaatacttcttccgggtctctgcag
aaaaccaagctggtctgagtgacccaagggagctcctgcttcctgtcctcataaaggatc
atctagaaccacctgaaattgacatgaagaatttcccaagtcacacagtgtatgtccgag
ccggttccaaccttaaagttgacatcccaatttctggaaagccactacccaaagtgacct
tatcaagagatggtgtgcccgtgaaggcgaccatgagatttaatactgagatcactgctg
agaacctcaccatcaatcttaaagaaagtgttaccgctgatgctggaaaatacgagatca
ctgctgccaacgccagtggaaccaccaaaaccttcattaacatcattgtgctggacaggc
ccggtcctcctactggccctgttgccattagtgatataaccgaagaaagtgtgactctca
agtgggagccacccaagtatgatggtggaagccatgttaccaactacatcgttctgaaga
gagaaacaagcactgcagtgtggactgaggtgtcggtgacagtagcgagaaccatgatca
aagtcatgaaactgaccacgggagaagaataccagttccgcatcaaggcggagaatcgct
tcggcatcagcgatcacatagattcggcctgtgtggttgtcaaactaccatacacgacac
ctggaccaccatccacaccctgggtctctaacgtgactcgcgaaagcatcactgtgggct
ggcatgagccagtgtccaatggaggcagtgcagtcacaggctaccacttggaaatgaaag
acagaaacagtattttgtggcaaaaagccaacaaaatgatcatccgtacaactcacttca
aagtcaccacaatcagtgctgggcttatttatgaattcagggtgtatgcagaaaacaccg
ctggtattggaaaacccagccatccttctgaaccagtcttggccattgatgcctgtgaac
ccccaagaaacgtgcggatcactgatatttcgaagaactctgtcaacctttcatggcaac
aaccagcctttgatggaggaagcaagattacaggctacgttgttgaaaggcgtgaccttc
cagatgggaggtggaccaaggccagcttcaccaatgttattgagactcaattcacagtct
ctggcttgactcagaattcccagtatgaattccgggtctttgctagaaatgctgttggct
ctgtcagcaacccatctgaggtcattggccccatcacatgcattgactcttacggtggtc
ctgtgattgacttgcctctagaatatacagaagtcgtcaaatacagagcaggaacatctg
tgaagctccgggctggcatttctggcaaacccgagcctaccattgagtggtacaaagatg
ataaagaattacaaaccaatgcattggtgtgtgttgaaaatagcactgacctggcatcta
tcctcatcaaagatgccaaccgcctcaatagcggaagctatgaattaaaactaaggaatg
ccatgggttctgcctcagccaccatcagagttcagatccttgacaaaccaggacctccag
gtgggccgattgaatttaggactgtcactgcagaaaagataacactgctctggaggccac
cggctgatgatggcggtgcaaagatcactcactacattgtggagagacgtgagaccagcc
gagtcgtgtggtctatggtggctgaaaacctggaagagtgcatcattacaactaccaaaa
ttatcaaagggaatgagtacatcttccgagtccgagctgtgaacaaatatggaactggcg
agccactggaatctgatccagtcgtagccaagaatgcctttgttacacctgggcccccaa
gcatcccagaggtaacgaagactaataagaattcaatgactgttgtctgggacagaccaa
ctgtagatggtggtagtgaaataaatggctatttcctcgaaagacgagacaagaagagtc
tagcatggcttaaagtactaaaggagactattcgtgacaccagacaaaaggtgacgggac
tcacggaaaacagtgactatcaataccgagtctgtgctgtaaatgccgctggaatgggtc
cattctcagaaccatctgacttctacaaggctgctgatcctattgatcctccaggcccac
ctgccaagataagaattgcagattcaacaaaatcatccatcactctcggctggagtaaac
ctgtctatgacgggggcagtgatgtcactggctatgttgttgagatgagacagggagagg
aggaggaatggactattgtctctaccaagggagaagtcagaactacagaatatgtggtgt
ctaacctgaaacccggagtcaattactatttccaagtgtcggcagtaaactgcgctggcc
agggagaacccataacaatgactgaacctgtgcaagctaaagacatccttgaggaaccgg
aaatcgacctagatgtggctctcagaacatctgtgatagctaaagctggagaggatgtgc
agctgttgattccctttaaaggcaggcctccgcctactgtcacctggaggaaagaggaca
agaatcttggcagcgatgccagatacagcatccaaaacaccgattcctcgtccttactgg
ttattcctcaagtcacccgccacgacacaggcaaatacgtcctcacgatagaaaatggag
tcggccaaccgaagtcgtccaccgtgactgttaaggtgctcgacacgccagctgcctgcc
agaagctgcagctgaaacacgtttccctaggcacagtcacactgctgtgggatcctcctc
tcatcgacggagggtctcctgtcattaattacgtcatcgaaaagagagacgccaccaaga
gaacatggtctgtcgtgtcacacaagtgttccagcacagccttcaaggtgacagacttat
cagagaaaactccattcttcttcagagttcttgcagagaatgaaatcggagtgggtgagc
cctgtgagactacagagcctgtgaaggctgctgaggtgccagcacccatccgtgatctct
cgatgaaagactccacaaagacatccgtggtcctgagctggaccaagcccgacttcgatg
gtgggagcatcatcacagactatgttgtggaaaggaaaggcaagggagaacaagcatggt
cacacgctggcatcagtaagacatgcgaaattgagatcgggcagcttaaagagcagtccg
tcttggaattccgagtgatggctcgaaatgagaaaggtcagagcgaccctgtcactattg
ggccacttacagtgaaagagcttgtaattacacctgaagttgacttgtcggaaatccccg
gggcacaaatatctgtgagaattggacataatgtacaccttgagttaccttacaagggaa
aacccaaaccatccatcagttggcttaaagatggcttgccattgaaagagagtgaatatg
ttcgtttcagtaaaacagaaaacaaaattaccctgagtattaagaatgtgaagaaggagc
atggagggaaatacagtgttattctcgataatgctatatgtagaaactctttccccatca
caatcatcacccttggcccaccatcaaaacccaagggacccattcgatttgatgaaatca
aggccgacagtgccatcatgtcgtgggatgtacctgaagatgatggaggaggagaaatta
cttgctatagcattgagaagcgggaagcctcacaaactaattggaagatggtgtgctcaa
gtgtcgccagaacaacgttcaaagtttccagtctggtcaaagattctgaatatcagttta
gagttagagcggaaaaccgatatggcgtcagtgagccacttgtctcaaatattatcatgg
caaaacaccagttcaggattcccggccctccaggaaagccggtaatttacaatgtgactt
cggatggcatgtccctaacttgggatgcgccagtttatgacggcggctcggaagttactg
gattccatgttgagaagaaggaaagaaacagcattctctggcaaagggttaacacatcgc
caatatctgggagagaatacagagctaccggtttaatagagggactggactaccagttcc
gagtatatgccgagaattctgctggcctgagcaagcctagcgatgccagcaagtttacct
tggctgtttccccagtagacccacctggaactcctgactacatcgatgtcacccgggaaa
ccattacactgaaatggaaccctccactgcgtgatgggggcagtaagatcgtggcctaca
gcatcgagaaacggcaagggaatgaccgctgggttagatgcaacttcacggacgtcagcg
aatgtcagtacacagtcacaggccttagtcctggggatcggtatgagttcagaatacttg
ctagaaatgctgttgggactataagcccgccctcacagtcttccggcatcatcatgacaa
gggatgaaaacgtcccaccaacagtagagtttggccctgagtacttcgacggtcttgtca
ttaagtctggagacagccttagaatcaaagctttggtccaaggacgaccagtaccacgag
taacttggttcaaagatggagttgaaattgagaggagaatgaacatggagataactgatg
ttcttggctccaccagcctctttgttagagatgcaacccgagatcaccgtggtgtttaca
ccgtcgaagccaaaaatgtatctggttccacaaaagcagaaattacagtcaaagtacaag
atacaccagggaaggtcgtggggccgatacgattcactaatatcactggtgaaaagatga
cgctgtggtgggatgccccactcaatgatggctgtgcgcctgtcacccactacatcattg
aaaaacgggaaaccagcagacttgcttgggcgttaatcgaggacaactgtgaagcccaca
gttacactgccattaaactaataaccggcaatgagtatcagttccgggtgtccgcagtta
acaagtttggtgtgggcaggccactggaatccgaccccgtggttgctcaaatacaataca
ccattccagacgcccccgggattccggaacctagcaacgtaacaggcaacagcattaccc
tgacgtgggcaaggccagaatcagatggtggcaatgagatccgacactacatccttgaaa
ggagagaaaaaaagagcacccgatgggtcaaagtgaccagcaagcgacccatctctgaga
cgagattcaaagtcactggcctggtagaagggaacgagtatgaattccacgtcatggccg
aaaatgctgcgggggtaggaccagcaagcggcatctcaagactgattaaatgcagggagc
ctgttaacccacccagcgccccctcggtggtcaaagtgacggacacatcaaagacgaccg
tgagcttagagtgggccaggccagtctttgacggcgggttggaaataattgggtacgtga
tagaaatgtgcaaagccgacttaggggactggcacaaggtgaacacggagccctgtgtga
aaacaagatacacagtcacggacctgcaggccggcgaagagtacaagttccgggtcagcg
ccgtcaacgctgccgggaaaggagacagctgcgaggtgacaggcaccataaaagcagttg
atcggctatcggctcccgagttagacattgatgcaaacttcaagcagactcacattgtca
gagcgggagccagcatccgcctcttcatcgcctatcagggtaggcccactcccacagcgg
cgtggagcaagcctgactcgaacctcagcatccgggcggacatccacaccacagactcct
tcagcacgctcaccgtggaaaactgcaaccgaaccgacgcggggaagtacaccctcacgg
tggaaaacaacagtggcagcaagtccataacgttcaccgtgaaggtgctggactctccag
gccccccaggcccaatcaccttcaaggacgtgacccggggctcggccaccctgatgtggg
atgcccctctcctggatggcggtgcccgaatccatcactacgtggtagagaagcgagaag
cgagtcgccgcagctggcaggttgtcagcgagaaatgcactcgccagatcctcaaggtcg
gcgacctgacggaaggcgtgccctactatttccgggtctctgccgaaaacgagtacggtg
tgggtgaaccctatgaaatgcccgaaccaatcgtagccacggaacagcccgctccgcctc
ggagacttgatgtcgtggacaccagcaagtcctccgccgtcctggcttggctgaagcctg
atcacgacggaggcagccggatcacgagctacctgcttgaaatgaggcagaagggctccg
acttctgggtggaggccggccacaccaaacagctcaccttcacggtagagcgcctggtgg
agaacaccgaatacgaattccgggtgaaagccaagaacgacgccggctacagtgagccca
gggaagccttctcgtctgttatcatcaaggagccgcaaatcgagcccactgcggacctca
cgggaatcaccaatcagctcataacctgcaaagccggaagcgcctttaccatcgacgtgc
caatcagtgggcgccccgcccccaaagtgacctggaaactagaagaaatgagactcaagg
agacagaccgaatgagcatcacgacaacaaaagacaggaccaccctgactgtaaaggaca
gcatgagaggggactcgggccggtacttcctgaccctggaaaacacagctggggttaaaa
catttactgtcacggttgtggtcattggaaggccagggccagtaactggtcctatcgagg
tctcctccgtctcagctgaatcctgtgtcctgtcatggacggagccaaaggacgatggtg
gcactgaaattaccaattacatagttgaaaagcgcgagtcgggaacaacagcctggcagc
tcatcaactccagcgtcaagcgcactcagattaaagtcacccacctcacaaaatacaaag
aatactgcttccgcgtcagttcagagaacagatttggggtcagcaagcccgtggagacgg
tgccaatagtcgctgaacatccatttgttccgccaagtgctcccacaagacctgaagtct
actatgtatccgccaatgccatgtcaattcgctgggaagagccctaccacgatggtggca
gcaaaatcgttggttactgggtggagaagaaagagcgaaacaccatcctgtgggtgaagg
aaaacaaggtgccatgtctagagtgcaactacaaggtgacgggcctcgtggaggggctgg
agtatcagttccggacatatgcgctcaacgccgcgggcgtcagcaaggccagcgaggctt
ccagacccatcatggctcaaaatccagttgatccaccgggtagaccagaagtgacagatg
tcaccaggtcaacagtgtcgctgatttggtctgccccggtctatgacggaggcagcaaag
tcgtgggctacatcatagagcggaagccagtcagcgaggttggagatggtcgctggctca
agtgcaactataccattgtctctgagaattccttcactgtgaccgccctcagtgaaggag
acacttacgagttccgggtgctggccaagaacgcagctggggtaatcagcaaaggctccg
agtccacaggccctgtcacttgccgagacgaatacgctccacccaaagccgaactagacg
ccaggttacaaggcgacctggtgaccatccgggcaggttcagatcttgttctcgatgctg
ccgttggcggcaaacctgaacccaaaatcatctggaccaaaggagacagggaactggatc
tctgtgaaaaggtctctctgcagtacactggcaagcgagcaacagcggtgatcaaatact
gtgaccgaggcgacagtggaaagtacacactgacagtcaggaatgccagtgggaccaagt
ccgtagctgtcatggtgaaggttcttgactcccccggcccctgcggaaaactcaccgtca
gcagagtaacggaggagaagtgcaccttggcctggagccttcctcaggaagacggaggag
cagagataactcactacattgtagagagacgagagaccagccggctcaactgggtgatcg
tggaaggggagtgcctgaccctgtcctacgtggtcaccagactcatcaagaacaacgaat
acacattccgagtgagggcagtgaacaagtacggcctgggcgtgccggttgaatcggagc
ccgtcgtggccagaaactccttcacgattccatcgcaacctggcataccagaggaagtgg
gggctggcaaagagcacatcatcattcagtggacgaagcccgaatccgagggtggcaacg
aaatcagcaactacctcgtggacaaacgcgagaagaagagcctgcgctggacacgtgtca
acaaagactatgtggtgtacgacaccaggctgaaggtgaccggcctcatggaaggctgtg
actatcagttccgggtgactgcggtgaacgccgctggcaacagcgagcccagtgaagctt
ccaacttcatctcctgcagagagccctcatacacccctgggccgccttccactccgaggg
ttgtggataccaccaaacgcagtattagcttggcatggaccaagcccatgtacgatggtg
gcgccgacatcatagggtatgtcctagagatgcaagagaaggacactgatcaatggtgcc
gagtgcatacaaacgctacaatcaggaacaacgaattcaccgtgacagacctcaaaatgg
gccagaaatactccttccgggtcgctgctgtgaacgtgaaggggatgagtgaatacagcg
aagcagttgctggaattgagcccgtggaaagactagaaataccagatcttgagcttgcgg
atgatctgaaaaagacagtgaccctcagggctggagcctcgttgcgcctgatggtgtctg
tatccggaagaccagctcctgtcatcacgtggagcaagaaaggcatcgaccttgccaatc
gggcgattattgacaacacagagagctactccttactcattgtggacaaagttaatcggt
atgatgccggcaaatacacaattgaagctgaaaaccaatctggcaagaaatcagcaacgg
tccttgttaaagtctatgatactcctggcccctgtccttcagtgaaggttaaggaagttt
caagggattctgtgaccatcacttgggagatccccaccattgacggcggcgctcccgtca
acaattacatcattgagaagcgagaagccgctatgagagcattcaaaacagtaaccacta
agtgcagcaagactctgtaccgaatctctggcctcgtcgagggaaccatgtactacttta
gagtgcttcccgagaatatctacggcatcggagagccttgtgaaacatcagacgcagttt
tggtctcggaagttcctttggtgcccacaaagctagaagtggtcgatgtcaccaaatcca
ccgtgacccttgcctgggaaaaaccactctatgatggcggaagccgcctcactggatacg
ttcttgaggcctgcaaagctggtacagagagatggatgaaagtcgtcactctgaagccca
cgatcttagagcacactgttatctccttgaatgaaggtgaacagtacttgtttagagtga
gggcacagaatgagaaaggtgtgtcggagccaagagagatcgtcacagctgtgactgtgc
aagacctcagagtgttgccaacaattgacctttctacgatgcctcagaagaccatccacg
tcccagctggcagaccaatcgagctggtgatccctatcgctggccgccccccacctactg
cttcctggttctttgctggctctaaactgagagaatcagaacgtgtcacagttgaaaccc
acactaaagtcgccaagttaaccatccgtgaaactactataagagacactggagaatata
cactcgaattgaagaatgtcactggaactacctcagagaccataaaagttattattcttg
acaagcctggtccaccgactgggcccatcaagattgacgagatcgatgctacgtccgtta
cggtctcctgggaagcccccgagctggatgggggcgctccgctaagcggctacgtggtgg
aacagcgtgacgcccatcggccaggatggctgccggtctccgagtccgtgacgagaccca
catttaagtttaccaggctcacggaagggaatgaatatgtgttccgtgtggccgcaacca
accgcttcgggattggctcctacttgcagtctgaggtcatagagtgccgaagcagcacca
gcattcctggacctccagaaacattacagatatttgatgtctctcgtgacggcatgacac
tcacgtggtatccaccagaagatgatggtggctcccaagtgaccggatatatcgtggaac
gtaaagaagtaagagcggatcgatgggtccgtgtaaataaagtgccggtgacaatgacaa
ggtaccgctccacaggccttattgaaggcttagaatatgaacaccgcatcacagccatta
acgcaagagggactgggaaaccaagtcgtccttccaaacccatcgttgccatggacccaa
ttgctccaccaggaaaacctcaaaacccaagagttacagatacaacaaggacatcagtct
ccttggcctggagtgttccagaagatgaaggtggctctaaagtcacagggtacttgattg
aaatgcagaaagtagatcaacgtgaatggaccaaatgcaacaccaccccaaccaagattc
gggagtacaccctaacacacctacctcagggcgctgaatacagattccgtgtcctagcct
gtaacgctggcggacctggggagcctgctgaggtaccaggcacagtcaaagtcacggaga
tgctagaataccccgactacgaacttgacgaaagataccaggaaggtgtgtttgttcgac
aaggtggagtcatcagacttaccataccaatcaaaggaaaaccattcccaatatgcaaat
ggaccaaggaaggccaggatatcagtaagcgcgccatgatcgcaacgtccgagacacata
ccgagcttgtgatcaaagaagcagacagagatgattctggaacctatgacttggttctgg
aaaacaagtgtggcaagaagaccgtttacatcaaggtcaaggtgataggaagtcccaacg
ctccggaagggccactcgaatatgatgacatccaagctcgatccgttagggtcagctgga
gacctcctgctgatgatggtggtgctgacatcttgggctacatccttgagagaagagagg
tacctaaggctgcctggtataccatcgactccagggtcagaggcacatctctggtcgtaa
aaggcctcaaagaaaatgtggagtaccacttccgcgtctcagcggaaaaccagtttggca
taagcaaacccttgaaatccgaggagccggtcataccgaagacacccctgaatccaccag
aacctccaagcaatcctcctgaagtacttgatgtgaccaaaagttctgttagcttgtcct
ggtctcgacctaaagacgacggtggctctcgagtcacaggctactacattgaacgcaagg
agacgtccaccgacaagtgggtccgacacaacaaaacccagatcaccaccacgatgtaca
ctgtcaccggccttgtccctgacgcggaatatcagttccgcatcatcgcccagaatgatg
ttggccttagtgagaccagccctgcttctgagccagttgtttgcaaagatccctttgata
agccaagtcaaccaggagaacttgagattctttcaatatccaaagacagtgtcactctcc
agtgggagaagcccgaatgtgatggtggcaaagaaatccttggctattgggttgagtaca
gacagtccggagatagtgcctggaagaagagcaataaggaccggatcaaggacaggcagc
tcaccgtcgggggcttgctagaggctaccgaatatgagttcagggttttcgctgagaatg
agacggggctgagccgaccacggagaacagctatgtctgtaaagactaaactcacatccg
gagaagccccaggcgttcggaaggaaatggccgatgtgaccaccaaattaggcgaagttg
ctcaactgtcgtgccagatagttgggaggccccttcctgacatcaaatggtaccgattcg
gtaaagagctcatacaaagccggaagtacaagatgtcctcggatgggcgcacacataccc
tggcagtaatgaccgaggaacaggaagacgaaggtgtttacacgtgcgtagctacgaatg
aggtaggagaagtagagaccagcagcaagctgcttctgcaagcggcaccacagttccacc
ccggctacccactcaaagagaaatattacggtgccgtgggctccacgcttcggctccacg
ttatgtacatcggccgcccagtaccggccatgacttggttccatggccagaaacttctgc
aaaactcagaaaacattactattgaaaacactgagcactatactcatctcgtcatgaaga
acgtccagcggaagactcacgctgggaaatacaaggttcagctcagcaacgccttcggga
cagttgacgccaccctggacgtggaaatacaagataagccagacaagcctaccgggccca
ttgtgatcgaagccctcctgaagaactccgtggtcatcagctggaagcctcctgctgatg
acggtggctcctggatcaccaactacgtggtggagaagtgcgaggccaaggaaggggctg
aatggcaattggtgtcttcagccatctcagtgacaacctgcagaatcgtgaacctcacag
aaaacgccggctattacttccgagtgtcggctcagaacacctttggcatcagtgagccct
tagaggtcgcctccatcgtgatcatcaagagtccatttgaaaagccaagtgttcctggta
gaccaaccatcactgctgtcacaaaagattcctgtgtggtggcttggaagccaccggcaa
gtgatggaggcgcaaagatcagaaattactacctagagaagcgtgagaagaagcagaaca
agtggattgctgtgacgacggaagagattcgagaaacggtcttctccgtgcaaaacctta
ttgaaggtcttgaatatgagttccgcgtgaaatgcgaaaacctaggcggggagagcgagt
ggagtgaagtctcagaaccggtcactccaaaatccgacgtcccgatccaggccccacact
tcaaggaagagctgagaaacctgaatgtccgctatcagagcaacgccactctggtctgca
aggtgaccggccacccgaagcccatcgtgaaatggtacaggcaaggcaaagagatcatcg
cggacggactcaagtacagaattcaggaatttaagggcggttaccaccagctcatcattg
caagcgtcacggatgacgatgccaccgtttaccaggtcagagccaccaaccaagggggat
ccgtgtccggcaccgcctccttggaagtagaagttccagcgaagatacacctgcccaaga
ccctcgaaggcatgggagcggtgcacgcgctccggggggaggtggtcagcatcaagatcc
ccttcagcggcaaaccagatccagtgatcacctggcagaaaggacaggacctcattgata
acaatggccactaccaagtgatcgtcacaaggtccttcacgtcgctcgtcttccccaacg
gggtggagagaaaagacgccggcttctacgtcgtgtgtgctaagaacaggtttggcattg
accaaaagacggttgaactggatgtggctgatgtccctgacccacccagaggtgtcaaag
ttagtgacgtctcacgagattctgtcaacctaacatggacagagccagcttcggacggcg
gtagcaaagtcaccaactacattgttgaaaaatgtgcaactactgcagagaggtggctcc
gtgtggggcaggcccgagaaacacggtacactgtgatcaacctattcgggaaaaccagct
accagttccgggtaatagccgaaaacaagtttggcctgagcaagccttcagagccctcag
agccaaccgttaccaaagaagacaagaccagagctctgaactatgatgaggaggtggatg
aagcccgggaggtcaccaagacgaaagcttcacactctaaaactaaggaactctatgaga
aatacatgatagcggaagatcttggccgtggagagtttggaattgtccaccggtgtgtcg
aaacgtcctccaagaagactttcatggccaaattcgttaaagtcaaagggacggatcagg
ttttggtcaagaaagagatttccattctaaatattgctaggcacagaaacatcttatacc
tccatgaatcatttgaaagcatggaagaattagttatgatctttgaatttatatcaggac
tcgacatatttgaacgcatcaacacaagtgcctttgaactcaacgagcgagaaatcgtga
gctacgtccgccaagtctgcgaagcactggagttcttacatagtcagaatatcggccact
ttgacattcggcccgaaaatatcatttaccagacaaggaagagctccgtcattaaaataa
tagaattcggccaggcgcgccagctgaagcccggtgacaacttccggcttctcttcagcg
cccctgaatactacggcccggaagtgcaccagcacgacgtcgtcagctccgccacagaca
tgtggtcgctcggcacgctggtgtacgtgctgctgagtggaatcaacccgtttttggctg
aaacgaaccaacagatgattgagaacatcatgaatgccgaatatacgtttgatgaagaag
cgttcaaagaaattagccttgaggcgatggactttgtggaccggctgttggtgaaggaga
ggaaatctcgcatgacggcgtccgaggccctgcagcacccatggctgaagcaaaggctag
agagagtcagcactaaagtcatcaggacactgaggcaccggcggtactaccacaccctca
tcaagaaagacctcaacatggtggtgtccgcagcccgcgtctcctgtggcggcgcaatcc
gatcccagaggggggtgagcgtggccaaagtcaaagtggcatccattgaaattggcccgg
tctccgggcagatcatgcacgccgttggcgaagaaggcggctacgtcaagtacgtctgca
aaattgaaaactacgatcagtccacccaggtgacctggtactttggcgtgagacagctgg
agaacagtgagaaatacgagatcgcctacgaagatggagtggccaccatgtacgtcaaag
acatcaccaagttcgatgacggcacctacagatgcaaagttgtcaacgactacggggagg
acagctcttacgcggagctgtttgttaagggcgtgagggaagtctctgactactactgcc
gcaggaccaagagggtcaagcgcagaacagacgccatgcggctcctcgagaggccgccag
agttcacgctgcctctctataacaagacggcctacgtgggcgaaaacgtgcgcttcggag
tcaccattaccgtgcaccccgagcctcgtgtgacgtggtataaatcgggccagaagatca
agccaggggacgacgaaaagaagtacacattccagtctgacaagggtctttaccagttga
cgatcaacagcgtcaccgcggatgacgacgccgagtacaccgtggtggcaaggaacaagt
atggcgaggacagctgcaaagcaaagctcaccgtgactctgcacccacccccgacggaca
ccatgctcaggcccatgttcaagcggctgctggccaacgccgaatgccacgagggccaaa
gtgtctgctttgagatcagggtgtccggcatcccggcaccaaccttgaaatgggagaaag
acggtcagccactgtccctcgggccccacatcgaaattgtccacgaaggcttggattatt
acgccctgcacatcagggacacgctgcccgaagacacgggctattaccgagtcacggcca
ccaacacggccggctccaccagctgccaggctcacctacaggtggaacggctgcgctacg
tcaagcaggaattccagagtaaagaggaacgggagcgccacgtccagaagcagattgaca
agaccctgaggatggcggaaatcctctccgggacggaaaccgtgcccttgacggcagtgg
cccaggaggctctgcgcgaggctgccattctttacaaacccgccgtgagcaccaagaccg
tcaaaggggagtaccggctgcagacggaggagaagaaagaggagagaaaactccgcatgc
cttacgaggtcccggagccgcgccggcgcacacaggccgccgtggaagaagaccagcgca
tcaagcagttcgtgcccatgtcggacatgaagtggtataagaagatccgagatcagtacg
agatgcccgggaagctggaccccgtggtccagaagcggcccaagcgcatccgcctctccc
gctgggagcagttctatgtgatgcccctgcctcgcctcacagatcagtaccgacccaagt
ggcgcatccccaggctgtcccaagacgacctggaaatggtgaggccggcccggcggcgca
gcccttcccccgactacgacctttattactaccggcggaggaggcgctcgctgggcgaca
tgtcggacgaggagctcctcctccccatcgacgactacctggcgctgaagaggacggagg
aggagcggctgcgcctggaggaggagcttgagctgggcttctccgcctcgccgcccagcc
ggagccccccgcgcttcgagctctccagcctgcggcccgcgtcgccggcggctgcggagg
aggagaggaggagggacctgagatactccgcctaccacatcccggccagggaggagacca
gcgccagctacgccgagctgcgggagcggcacgcccgcgccgcctaccggcagccccggc
tgcgccagaggatcctggccgagagggaggacgaggagctgctgaggcccgcggccaccg
cgcagcgactgtcggagtacagaagcgagctcgagcacctgtcgaaggaagagaggtcca
agaagacgtccacgcggcagagacgagtgacggaaatcaccgagatcgaagaggagtacg
aactctcccgacgggcgcaccgggagtcgtcggcctccgtgtcccggctcctgaggcgcc
ggcgctccctgtccccgacctacatcgagctcatgagacccgtgtccgagctgatccgct
cgcgcccgccgcccgccgaggacgacgacgaggacgcggagaggaggtcccccacccccg
agaggacgcgcccgcgctcccccagccccgtgtccagcgagcgctccctctcgaggttcg
agaggtcggccaggtttgacatcttttcccggtacgagtccatgaaggcggccctgaaga
gccagacgacgtcggagcgcaggtacgaagtcctgagccagcagcccttcacgctggacc
acgcgccccgggtcaccctgcggatgcgctcgcaccgggtgccgagcggccgcagcaccc
gcttcatcctcaacgtgcaggccaagcccaccgccgacgtgacgtggtaccacaacggcg
ccccgctccaggagggcggtagggtccgctgcaccaacaccagcggggtcctgaccttgg
agatcctggactgtcaggccgaggacagcgggacctaccgcgccgtgtgcaccaactaca
aaggcgaggcctcggactacgccaccctggacgtcaccggcggcgactacacgacctacg
cgtcccggcgcagggatgaggaggtccccaaggccgtcttccccgagctgacgaagacgg
aggcctacgccgtgtcctccttcaagaggacgtccgagctggaggccgcttcctccgtcc
gggaggtgaggtcggagatgacggagacgagggagagcatctcctcctacgagcagtacg
cgtccgcggaagtgaagagcgccgcctccgaggagaggtccctggaagaaagggccaccg
cgaggaaggcgcggaccacgctggccgccaggatcctgacgaagccgcggtccctgacgg
tgcgcgagggcgaggcggccaggttctcctgcgacacggacggggagccggtgcccgctg
tgacctggctgcggggcggacgggccgtcagcacttccgcccgccaccaggtgaccaccg
ccaagtacaagtcgaccttcgagatctcctcggtgcaggcctcggacgagggcggctaca
gcgtggtggtggtgaacagcgacggccagcaggaggcgcagttcacgctgaccgtgcaga
gagccaaggccgccgagaaggcggtggcgtcgccgccccgggtgaagtcccccgagcccc
gcgtgaagtccccggaaacagccaagtcccccaagagagtgaagtctccagagccagtga
cctctcccccaaaagctgtgtcaccgaccgagacaaagccagtgccaacagagaaggccc
gagagctcccagccgctgccccgccaaagataactcagtccctgagggcagaggcggcta
gggacatcgcaaagctgacctgtgcagttgaaagcagcgccctgtgtgccaaagaggtca
cctggtataaagacggcagaaaactcaaggaaaacgggcattttcaatttcactactcag
cggacggtacctacgaactcaaaattcacaaccttagcgaatctgattgcggagaatatg
tttgtgaggtctccggtgaaggaggaatttccaaaaccagcttccagtttactggacagt
ccttcaagagtatccgtgagcaggtgtcaagcatatcagaaactaagaaatcagcacaga
aaactgctgaggcaacagaggccaagaaagctgaaccagcagctcctgaatcagtttcct
caaagccagtaattgttactgggctgcaggatctaacagtttcttcagacagtgttgcta
aatttacagttaaagttactggagagccccagccaactgtcacctggacaaaggatggaa
aggctattgcacaaggcaataaatacaaactctctaaagacaaagaagaatttttcttag
aaatcctcaagactgaggcttccgatggaggactttatgcctgcacaataacaaattctg
ctggctccgtgtcctccagctgtaaactaacaataaaagcagtaaaagacacggaagcac
agaaaatatctactcagaagactgctcaagttacatctcagaagaaagcaagtatccaag
aggaaacgtctcaaaaggccagaacttctgaagaaatcaagatgtcagaggtaaaatctc
acgaaaagctagccatcaaggaggaagcatccaaagttctgattgccgaagaggtcaaga
aatcggcagcagcctccctggaaaaatccattgtccacgaagaagtcaccaaaacctcac
aggccttagaagtcaaaactcatgctgaaatcaaagcaatgtctacccagatgagcataa
ccgatggtcagaaagtaactctgaaagccaacattgctggggccacggatgtgaaatggg
tactgaatggcgtggagctcgctaactcagaggagtacagatacggggtatccggcagtg
accaaaccctcaccatcaagcgagccagccacagagatgaaggaatcctcacctgcatag
gcagaaccagtcagggaatcgtcaagtgtcagtacgacttgaccctgagcaaagaaatct
cagatgcccctgccttcatctcacaacccagatcccagaacatcaacgaaggacaaaacg
ttctcttctcgtgtgagatcagcggggagccatcccctgaaattgagtggtttaaaaaca
acctgccgatttccatttcttcaaatatcagtgtgagccgctccagaaatgtgtacactc
ttgaaatccgaaatgcgtctgtaagcgacagtgggaagtacacaattaaggccaaaaatt
tccatggccagtgttcagccacagcctcgctgacagtgcttcctctggttgaagaaccac
ccagagaggtagtattgaagacaagtggtgacacgagcttgcaaggaagcttctcgtctc
agtcagtccgaatgtccgcctccaagcaggaggcgtccttcagcagcttcagcagcagca
gcgctagcagcatgactgagatgaagtttgcaagcatgtctgcccaaagcatgtcttcca
tgcaagagtcctttgtagaaatgagttccagcagttttatgggaaaatctagcatgacac
aactggaaagctcaaccagtagaatgctcacagcaggcggaagaggaattccacctaaaa
ttgaagctcttccctctgacatcagcatcgatgaaggcaaagttctaacggtggcctgcg
ctttcactggggagcccactccggaaataacatggtcctgtggtggaaggagaatccaaa
accaagaacaacaaggacgattccacattgaaaacacagacgacctgacaaccctgatca
tcatggacgtacagaaacaagatggtggactttataccctaagtttagggaatgaatttg
gatctgattctgccactgtgaatattaatatccgttctatgtaa

DBGET integrated database retrieval system