KEGG   Meriones unguiculatus (Mongolian gerbil): 110556521
Entry
110556521         CDS       T05884                                 

Gene name
Adcy4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00230  Purine metabolism
mun01100  Metabolic pathways
mun01522  Endocrine resistance
mun04015  Rap1 signaling pathway
mun04020  Calcium signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04072  Phospholipase D signaling pathway
mun04114  Oocyte meiosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04261  Adrenergic signaling in cardiomyocytes
mun04270  Vascular smooth muscle contraction
mun04371  Apelin signaling pathway
mun04540  Gap junction
mun04611  Platelet activation
mun04713  Circadian entrainment
mun04714  Thermogenesis
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04727  GABAergic synapse
mun04742  Taste transduction
mun04750  Inflammatory mediator regulation of TRP channels
mun04911  Insulin secretion
mun04912  GnRH signaling pathway
mun04913  Ovarian steroidogenesis
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04918  Thyroid hormone synthesis
mun04921  Oxytocin signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04925  Aldosterone synthesis and secretion
mun04926  Relaxin signaling pathway
mun04927  Cortisol synthesis and secretion
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04970  Salivary secretion
mun04971  Gastric acid secretion
mun04972  Pancreatic secretion
mun04976  Bile secretion
mun05032  Morphine addiction
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110556521 (Adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110556521 (Adcy4)
   04371 Apelin signaling pathway
    110556521 (Adcy4)
   04020 Calcium signaling pathway
    110556521 (Adcy4)
   04072 Phospholipase D signaling pathway
    110556521 (Adcy4)
   04024 cAMP signaling pathway
    110556521 (Adcy4)
   04022 cGMP-PKG signaling pathway
    110556521 (Adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110556521 (Adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110556521 (Adcy4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110556521 (Adcy4)
   04062 Chemokine signaling pathway
    110556521 (Adcy4)
  09152 Endocrine system
   04911 Insulin secretion
    110556521 (Adcy4)
   04923 Regulation of lipolysis in adipocytes
    110556521 (Adcy4)
   04912 GnRH signaling pathway
    110556521 (Adcy4)
   04913 Ovarian steroidogenesis
    110556521 (Adcy4)
   04915 Estrogen signaling pathway
    110556521 (Adcy4)
   04914 Progesterone-mediated oocyte maturation
    110556521 (Adcy4)
   04921 Oxytocin signaling pathway
    110556521 (Adcy4)
   04926 Relaxin signaling pathway
    110556521 (Adcy4)
   04935 Growth hormone synthesis, secretion and action
    110556521 (Adcy4)
   04918 Thyroid hormone synthesis
    110556521 (Adcy4)
   04928 Parathyroid hormone synthesis, secretion and action
    110556521 (Adcy4)
   04916 Melanogenesis
    110556521 (Adcy4)
   04925 Aldosterone synthesis and secretion
    110556521 (Adcy4)
   04927 Cortisol synthesis and secretion
    110556521 (Adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110556521 (Adcy4)
   04270 Vascular smooth muscle contraction
    110556521 (Adcy4)
  09154 Digestive system
   04970 Salivary secretion
    110556521 (Adcy4)
   04971 Gastric acid secretion
    110556521 (Adcy4)
   04972 Pancreatic secretion
    110556521 (Adcy4)
   04976 Bile secretion
    110556521 (Adcy4)
  09156 Nervous system
   04724 Glutamatergic synapse
    110556521 (Adcy4)
   04727 GABAergic synapse
    110556521 (Adcy4)
   04725 Cholinergic synapse
    110556521 (Adcy4)
   04723 Retrograde endocannabinoid signaling
    110556521 (Adcy4)
  09157 Sensory system
   04742 Taste transduction
    110556521 (Adcy4)
   04750 Inflammatory mediator regulation of TRP channels
    110556521 (Adcy4)
  09149 Aging
   04211 Longevity regulating pathway
    110556521 (Adcy4)
   04213 Longevity regulating pathway - multiple species
    110556521 (Adcy4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110556521 (Adcy4)
   04714 Thermogenesis
    110556521 (Adcy4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556521 (Adcy4)
  09165 Substance dependence
   05032 Morphine addiction
    110556521 (Adcy4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    110556521 (Adcy4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110556521 (Adcy4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110556521 (Adcy4)
   05163 Human cytomegalovirus infection
    110556521 (Adcy4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110556521 (Adcy4)
Enzymes [BR:mun01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110556521 (Adcy4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 110556521
NCBI-ProteinID: XP_021506006
Position
Unknown
AA seq 930 aa
MARLFSPRPPPSEDLSYETYYSLSQQYPLLLLLLVIVLCALLALPAVAWASGRELTSDPG
FLTTVLCALGGFSLLLGLASWEQQLQRWTRPLSGLIWAALLALGYGFLFTGGVVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAVAGLTSSLSHLLVLGVYLGWQPDPQRALLPQLAANAVL
FLCGNVVGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMTRLQAGQRSRPENTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAVNCVRMGLDMCRAIRKLRVATG
VDVSMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEKADMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAKGLLASLEGHKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLPVRMPTSGATQLKPPCVRGVYCLSAHLLPQLFL
PVSSDCPFLASNVSSVAFNGSSELPGPLPLISIPYSMHCCVLGSLSCSLFLHMSFELKLL
LLLLWLVASCSLFLHSHAWLSDCLIAHLYRSPLGSRPGVLKEPKLMGATYFFVFFFTLLV
LARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLY
HQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIK
TIGSTYMAATGLNATSGQETQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRV
GLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYS
RGVIKVKGKGQLCTYFLSTDLTRTGSPSAL
NT seq 2793 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggcctcctcccagcgaagatctctcctacgagacctac
tacagcctgagccaacagtacccactgctgctgctgctcctggtcatcgtgctctgcgcg
ctcctggcactgcccgctgtcgcctgggccagcggcagggagctgacctcagacccaggc
ttcctaacaactgtgctgtgtgcattgggtggcttctctctgctgttggggctagcttcc
tgggagcagcagctgcagcgatggactcggcctctttctggcctcatatgggctgcactg
ctggccctgggctatggattcctgttcactgggggtgtggtgagcgcctgggaccaggtg
tcgtttttcctcttcatcatcttcaccgtgtatgccatgctgcccttgggcatgcgagat
gctgccgtcgcaggcctcacctcatcactctcacacctgctggtccttggagtgtacctc
gggtggcagcctgacccacagagggctctgctaccgcagctggcggcaaatgccgtgctg
ttcctgtgcgggaacgtggtgggagcataccataaggccctgatggagcgagccttgcgg
gccaccttccgggaggctctcagctctctgcactcacgccggaggctggacaccgagaag
aagcaccaggagcacctccttttgtccatcctccccgcctacctggcccgagagatgaaa
gcggagatcatgacacggctgcaggccggacagaggtcacggccagagaacacaaacaac
tttcacagcctgtatgtcaagaggcaccaaggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaacgag
ctcttcggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatcctg
ggggactgttactactgcgtctccggactgccgctctccctgcctgaccacgctgtcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactccgggtagccaccggc
gtggatgtgagcatgcgcgtgggtgtgcactcgggcagcgtgctctgtggggtcatcggg
ctgcagaagtggcagtacgacgtctggtcccacgatgtcacactggccaaccacatggaa
gctggcggtgtaccaggacgagtacacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggagaaggcagacatggaacaccgggacccataccttcgggagctaggc
gaacctacgtacctggtcatcgatcctcgggctgaggaggaagacgagaagggcaccgcg
aagggactgctggcttctttggaggggcacaagatgcgcccatccctgctgatgactcgt
tacctggagtcttggggtgcagccaagcctttcgcccacttaagccacgttgacagtcct
gtatccacctccactccgctgccggtgcgtatgcccacctcaggggcaacccagctgaag
cctccctgtgtccggggagtttactgcctttcagctcatcttcttccgcagctcttctta
ccggtgtcatcagactgccccttcctggcttccaatgtatcttccgtggctttcaatggc
tcctcggagctgccagggcccctgcctcttatcagcatcccatactccatgcactgctgc
gtgttgggctccctctcctgctccctttttctgcacatgagctttgaactgaagctgctt
ctgcttctgctgtggctggtggcatcctgctccttgtttctgcactcccacgcctggctg
tctgactgcctcattgcccacctttatcgaagccccttgggctccaggcccggggtgctg
aaggaacccaaactgatgggagccacctacttcttcgtcttcttcttcacgctccttgtc
ctggctcggcagaatgagtattactgccgcctggacttcctgtggaagaagaagctgagg
caggagagggaggagactgagacgatggagaacctgacccggctcctcctggagaacgtg
ctccctgcacacgtggccccccagttcatcggccagaaccggcgcaatgaggacctctat
caccagtcgtacgaatgtgtctgtgtcctcttcgcatcggtcccagactttaaggaattc
tactctgagtccaacatcaaccacgagggactggagtgtctgaggctgctcaatgagata
atcgctgattttgacgagctgctctccaagccaaagttcagtggcgtagagaagatcaaa
actattggcagcacctacatggcagccacaggcttaaatgccacctctggacaggagaca
caacaggatgctgagcggagctgcagccatctgggcaccatggtggaattcgcagtggcc
ctggggtctaagctggacgtcatcaacaagcactcattcaacaacttccgcctgcgtgtg
ggcttgaaccacggaccagtagtagcaggggtgattggggctcagaagccgcaatacgac
atctgggggaacaccgtgaatgtggccagccgcatggagagcacgggagtcctcggcaag
atccaagtgactgaggagacagccagggccctgcagtccctgggttacacatgctacagc
cggggtgtcatcaaggtcaagggcaaagggcagctctgtacctacttcctgagcacagac
ctgacgcgaactggatctccctcagcattgtag

DBGET integrated database retrieval system