KEGG   Meriones unguiculatus (Mongolian gerbil): 110557833Help
Entry
110557833         CDS       T05884                                 

Gene name
Suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00020  Citrate cycle (TCA cycle)
mun00640  Propanoate metabolism
mun01100  Metabolic pathways
mun01200  Carbon metabolism
Module
mun_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mun_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110557833 (Suclg1)
   00640 Propanoate metabolism
    110557833 (Suclg1)
Enzymes [BR:mun01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110557833 (Suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110557833 (Suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 110557833
NCBI-ProteinID: XP_021508123
Position
Unknown
AA seq 346 aa AA seqDB search
MTAALVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKNIYVDKNTKVIC
QGFTGKQGTFHSQQALEYGTQLVGGTTPGKGGKTHLGLPVFDTVKEAKEKTGATASVIYV
PPPFAAAAIDEAIDAEISLVVCITEGIPQQDMVRVRHKLTRQGKTRLIGPNCPGIINPGE
CKIGIMPAHIHKKGKVGIISRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCL
EVFLNDPATKGIVLIGEIGGHAEEHASEFLKEHNSGPNAKPVVAFIAGITAPPGRRMGHA
GAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGSTMYKEFEKRKML
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggcgttagtagctgcagctgcgaccgcgaccatggtctccggcagcagcggc
ctcgctgctgcccgcctgctgtcgcgcaccttcctcctgcaacagaatgggatacgacac
gggtcttacacggcttcccggaaaaatatctatgttgataaaaacacgaaggttatttgc
cagggcttcacaggcaagcagggcacctttcatagccagcaggccttggaatacggcacc
caactcgtgggaggaaccacgccagggaagggtggcaagacacacctgggcttacccgtc
tttgatactgtgaaggaagccaaggagaaaacaggcgcgacagcgtctgtcatttatgtc
cctcctccttttgctgctgctgccatcgatgaagcaattgacgcggaaatttccttggtt
gtgtgcataactgaaggtatcccacagcaggatatggtacgcgtcaggcacaaactgaca
cgccaaggaaagacgaggctaattgggccaaactgccccggaatcatcaatcctggagag
tgcaaaattggcatcatgcctgcccatattcacaagaaaggaaaagtaggcattatatcc
agatccggcaccctgacctacgaagcagttcaccagacaacccaagttggactggggcag
tccttgtgtattggcattggaggtgacccttttaatgggacaaattttattgattgcctt
gaagtcttcctgaatgatcctgccacaaaaggtatcgtactgattggtgaaattggtggt
catgctgaagaacatgcttctgagtttctgaaggaacacaattcaggtccaaatgccaag
cctgtagtggccttcattgctggtataactgctcctcctggcagaaggatgggccacgca
ggggcaattattgctggaggaaaaggtggtgccaaagagaagatcgccgctcttcagagt
gcaggtgttgttgtcagcatgtcccccgcacagctgggctccaccatgtataaggaattt
gaaaagaggaagatgctgtga

DBGET integrated database retrieval system