KEGG   Meriones unguiculatus (Mongolian gerbil): 110558171Help
Entry
110558171         CDS       T05884                                 

Gene name
Plk4
Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110558171 (Plk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110558171 (Plk4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110558171 (Plk4)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     110558171 (Plk4)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   110558171 (Plk4)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110558171 (Plk4)
   Centrosome duplication proteins
    Regulators of centriole replication
     110558171 (Plk4)
  Sister chromatid separation proteins
   Polo kinases
    110558171 (Plk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal Haspin_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 110558171
NCBI-ProteinID: XP_021508622
Position
Unknown
AA seq 855 aa AA seqDB search
MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSENEARHFMNQI
ITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDIWSLGCMVYTLLIGRPPFDTDTVKNTLNKVVLADYEMPGFLSPEAQD
LIHQLLRRNPADRLSLSSVLDHPFMSQNPLTRSKDLGTVEDSMDSGHATLSTTITASSGT
SLSGSLLDRRRLLIGQPLPNKITVFQKNRNSSDFSSGDGSSICTQWGNPEQETSTRGRGR
VIEDAEERPHSRYLRRAHSSDRSSTSNQSHAKTYSIERCHSVEMLSKPRRSLDENEHSSN
HHCLGKTPFPFADQTPQMEMVQQWFGNLQMNARLGESNEHNPISPNKDLQGFPDLQDTVR
NAWIDMRASQNAGASSDVHPVMKYTTAHHSKPELMPQEPAVPRSEQSKNGSMESALGHQK
PTLRSITSPLIAHRLKPIRQKTKKAVVSILDSEEVCVELLKECASEGLVKEVLQISSDGT
MITVYYPNDGRGFLLADRPPLPTDNISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKIT
YFTRYAKCVLMENSPGADFEVWFYDGAKIHKTEDLIHVIEKSGKSYTLKNENEITTLKEE
IKIYMDHANEGHRVCLALESVISEEERRSRSSSFFPIIVGRKPGNASSPKALSPPVEPSC
SKGEQASSSRLSMNSAAFPTQAPVFNPSTVTAEGLGHTATATGTSFSSSSLPKSSQLLKS
VFVKNVGWATQVRHF
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtgcattggggagaggatcgaggactttaaggttggaaatctactcgggaaa
ggatcatttgctggtgtctacagagctgagtccattcacaccggtctggaagttgcaatc
aaaatgatagacaagaaagccatgtacaaagctggaatggtacagagagtccaaaatgag
gtgaaaatacattgccagttgaaacacccatctgtcttggagctctataattactttgaa
gataacaattatgtatatctggtattggaaatgtgccataacggagaaatgaacaggtat
ctaaagaacagaatgaaacctttctcagaaaatgaagccaggcacttcatgaaccagatc
atcacaggaatgttgtatcttcattctcatggcattttacaccgggacctcacactttct
aacatcttacttacgcgtaatatgaacataaaaattgctgactttggactagcaacgcag
ttgaaaatgccacatgagaagcactatacactatgtggaactcctaattacatttcacca
gaaattgcaactcggagtgcacatggacttgaatctgatatttggtcattgggctgtatg
gtttacacattacttattggaagaccaccttttgacactgatacagtcaagaacacattg
aataaagtagtattggcagattatgaaatgccaggctttttgtcacctgaggcccaggac
cttatccaccagttacttcgtagaaaccctgcagatcggttaagtctctcttctgtgttg
gaccatccttttatgtcacagaatcctttaacaagaagtaaagacttggggactgtagag
gactccatggatagtgggcatgccacactttctacaacaattacagcttcttctggcacc
agcttaagtggtagcttacttgacagaaggagacttttgattggtcaaccacttccaaat
aaaattacagtatttcaaaaaaatagaaattcaagtgacttttcttcaggagatggaagt
agtatttgtactcagtggggaaacccagagcaagaaactagtactaggggacggggaaga
gtaattgaagatgcagaggaaaggccgcattctcgataccttcgcagagctcattcctct
gatagatccagcacttctaatcagtctcatgcaaaaacgtactcaatagaacgatgtcac
tcagtagaaatgctttcaaagcccagaagatcactggatgaaaacgaacacagttccaat
catcattgtctaggaaaaactccctttccatttgcagaccagacccctcagatggaaatg
gtccaacagtggtttgggaatctgcaaatgaatgctcggttaggagaaagtaatgagcac
aaccccattagcccaaacaaggatctccagggctttccagatcttcaggacacagtaaga
aatgcctggattgacatgagagccagccagaacgccggtgcttcttctgatgtgcatcct
gtaatgaagtacacgactgcacaccacagcaagcctgagctcatgccacaagagccggcc
gtgcctcgttctgaacaaagcaagaatgggagcatggagtcagcactggggcaccaaaaa
cctaccttacgaagcatcacatctcctttgattgctcacagattaaaaccgatcagacag
aaaaccaaaaaggctgtggtgagcatccttgattcagaggaggtgtgtgtggaacttctc
aaagagtgtgcatctgaaggactcgtgaaagaagttcttcagatttctagtgacgggact
atgatcactgtttattatccaaatgatggaagaggctttcttcttgctgatagaccaccc
ttgcctactgacaatatcagtaggtacagctttgacaatttaccagaaaagtactggcgg
aaatatcagtatgcttccagatttattcagcttgtaaggtctaaaactcccaaaatcact
tattttacaagatatgctaaatgtgttttgatggagaattctcctggtgctgatttcgag
gtctggttttacgatggagccaaaatacataaaacagaagatttaattcatgtgattgaa
aaatctgggaaatcttatactttaaaaaatgaaaatgaaattaccaccttgaaagaggaa
ataaaaatatatatggaccatgctaacgagggtcaccgtgtttgcttggcactggaatct
gtaatctcagaagaggaaaggagaagcaggagctcttcattcttcccaatcattgtagga
agaaaacctggtaatgctagttcacctaaagccttatcaccacctgtggagccaagctgc
tcgaaaggagagcaagcatcatctagtagattgagcatgaatagtgcggcttttccaaca
caggcaccagtattcaatccttctactgtgacagctgaaggacttggccacacagccact
gctacaggaacaagcttctcttcttcaagtcttcctaaatcatcccagcttttgaaatct
gtttttgtgaaaaatgttggttgggccacacaggtgagacatttctga

DBGET integrated database retrieval system