KEGG   Meriones unguiculatus (Mongolian gerbil): 110558294Help
Entry
110558294         CDS       T05884                                 

Gene name
Crem
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110558294 (Crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110558294 (Crem)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110558294 (Crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID
Motif
Other DBs
NCBI-GeneID: 110558294
NCBI-ProteinID: XP_021508788
Position
Unknown
AA seq 173 aa AA seqDB search
MTMETVESQQDQSVTHSVAEHSSAHMQTGQISVPTLAQVSVAGSGTGRGSPAVTLVQLPS
GQTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSAESEVIDSHKRREILSRRPSYRK
ILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYSMYAMIP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggagacagttgaatcacagcaggatcaaagtgtaacacattctgtggcagag
cacagctctgctcatatgcagactggccaaatttctgttcctactctagcacaggtttct
gtagctggatcaggcactggaagaggctccccagctgtgactctagtacagttaccttca
ggccaaactgtacaggtccagggagtaattcagacaccacatccatcggttattcagtca
ccacaaatacaaactgttcaggtagcaacaattgcagagacagatgattctgcagaatca
gaagtaatcgattctcataaacgtagagaaattctttcacgaagaccctcatatagaaaa
atactgaatgaactttcctctgatgtgcctggtattcccaagattgaagaagaaaaatca
gaggaagaaggaacaccacctaacattgctaccatggcagtaccaactagcatatatcag
actagcacggggcaatacagtatgtatgctatgattccatag

DBGET integrated database retrieval system