KEGG   Meriones unguiculatus (Mongolian gerbil): 110559482Help
Entry
110559482         CDS       T05884                                 

Gene name
Parp1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03410  Base excision repair
mun04210  Apoptosis
mun04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    110559482 (Parp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110559482 (Parp1)
   04217 Necroptosis
    110559482 (Parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mun03032]
    110559482 (Parp1)
   03036 Chromosome and associated proteins [BR:mun03036]
    110559482 (Parp1)
   03400 DNA repair and recombination proteins [BR:mun03400]
    110559482 (Parp1)
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110559482 (Parp1)
DNA replication proteins [BR:mun03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110559482 (Parp1)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    110559482 (Parp1)
DNA repair and recombination proteins [BR:mun03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     110559482 (Parp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 110559482
NCBI-ProteinID: XP_021510600
Position
Unknown
AA seq 1013 aa AA seqDB search
MAEASERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHCIRQPDLEVDGFSELRWDDQQKVKKTAEAGGVSGKGQDGSGGKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPTCFVKNREELGFRPEYSASQ
LKGFSLLSAEDKEALKKQLPGVKSEGKRKCDEVDGMDEVAKKKSKKGKDKDSKLEKALKA
QNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCQECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPSRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSAPAPLAPPLSVTSAPAAVNSCAPADKPLSNMKILTLGKLSQNKDEAKAAIEKLGGKLT
GSANKASLCISTKKEVEKMSKKMEEVKAANVRVVSEDFLQDVSTSTKSLQELLSAHSLSS
WGAEVKVEPVEVVAPKGKSAAPSKKSKGPVKEEGVNKSEKRMKLTLKGGAAVDPDSGLEH
SAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKL
EQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVTPGT
KSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAVS
QGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGG
SDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIER
EGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSAS
ITLDGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcctcggagaggctttaccgagtggagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagtatccccaaggactcgctccgcatggccatcatggtgcag
tcgcccatgttcgacgggaaggtcccacactggtaccacttctcctgcttctggaaggtg
ggccactgcatccgacagcccgacctcgaggtggatggcttctcggagctgcgatgggat
gaccagcagaaggtcaagaagactgcagaggctggaggagtgtcagggaaaggccaggat
ggaagtggcggcaaggcagagaagacgctgggtgactttgcagccgaatatgccaagtcc
aacaggagcacatgcaagggctgtatggagaagatagaaaagggccaggttcgtctgtcc
aagaagatgctggacccagagaagccacagctgggtatgattgaccgctggtaccaccca
acctgcttcgtcaagaaccgggaggagctgggcttccggcctgagtatagcgccagccag
ctcaagggcttcagtctcctctctgcagaggacaaagaagcgctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaagtgtgacgaagtggatggaatggatgaggtggcc
aaaaagaaatctaaaaaaggaaaagacaaggatagtaagctggaaaaggccctgaaggcc
cagaacgaactgatctggaacatcaaagatgaactgaagaaagcatgttccaccaacgac
ctgaaggagttgctcatcttcaaccagcagcaagtaccgtctggggaatctgcgatcttg
gaccgagttgcggatggcatggcgtttggggcccttctgccctgccaggagtgttcaggc
cagctggtcttcaagagcgatgcctattactgtactggggatgtcacggcctggaccaag
tgcatggtcaagacacaaactcccagtcggaaggaatgggtgactccaaaggaatttcga
gaaatatcatacctcaagaaattaaaggtcaaaaaacaggaccggatattccctccagag
accagcgccccggcaccactggcacccccactctccgtcacctcagcacccgcagccgtg
aactcctgtgctccagcagacaagcccctatctaacatgaagatcctgaccctcggtaaa
ctctcccagaacaaagacgaagcgaaggccgcgattgagaagctcggggggaagctgaca
ggatcagccaacaaggcctccttgtgcattagcactaaaaaggaggtagaaaagatgagt
aagaagatggaggaagtgaaagcagccaatgttcgagttgtgtctgaagacttcctccag
gatgtgtccacctctactaagagcctccaagagctgctctcagcccacagcttgtcctct
tggggggctgaggtgaaggtggagcctgttgaagtggtggcccccaaggggaagtcagct
gcaccttccaagaagagcaagggccctgtcaaggaggaaggtgtcaacaagtctgaaaag
aggatgaaattaactctgaagggaggagcagctgttgatccggactctggtctggaacat
tctgcacacgtcctggagaaaggcgggaaggtgttcagtgccacacttggcctggtggac
attgtgaaagggaccaactcctattacaagctgcaacttctggaggatgacaaggagaac
aggtactggatcttccggtcctggggccgagtgggcacagttatcggcagtaacaaactt
gagcagatgccatccaaagaggatgctgttgagcacttcatgaaattatatgaagagaag
accggaaatgcctggcactctaaaaacttcacaaagtatcccaaaaagttctaccctctg
gagattgactatggccaggatgaagaggcagtgaagaagctgacagtaacgcctggcacc
aagtcgaagctcccgaagccggtgcaggagctcgtggggatgatcttcgacgtggaaagc
atgaagaaagccctggtggagtatgagattgaccttcagaagatgcccttggggaagctg
agcagaaggcagatccaggccgcctactccatcctcagtgaggtccagcaggcagtgtcc
caaggcagcagtgactcccagatcctggatctctccaatcgcttctacaccctgatcccc
catgactttggaatgaagaagcccccactcctgaacaatgcagacagtgtgcaggccaag
gtggagatgctagacaacctcctggacatcgaggtggcctatagtcttctcaggggtgga
tctgatgacagcagtaaggaccccatcgatgtcaactacgagaagctcaaaactgacatt
aaggtggttgaccgagattctgaggaggccgaggtcatcaggaagtacgttaagaacact
cacgcaaccacacacaacgcctacgacctggaagtgatagatatctttaagatagagcgt
gagggagagagccagcgctacaagcccttcaagcagcttcacaaccggaggttgctgtgg
cacgggtccaggaccaccaactttgccggcatcttgtcacagggtctgcggatagccccg
cctgaagcacctgtgacaggctacatgtttgggaaagggatctactttgccgacatggta
tccaagagtgcaaactactgccacacatctcagggagacccaatcggcttaatactgttg
ggagaagttgcccttggaaacatgtacgaactcaaacatgcctcacatatcagcaagtta
cccaagggcaaacacagcgtcaaaggtttgggcaaaaccacccctgacccttcggccagc
atcaccctggatggtgtagaggttccgctggggacagggatcccatctggtgttaacgac
acctgcctactgtataacgagtacattgtctacgacattgcccaggtgaatctgaagtac
ctgctgaaactgaagttcaattttaagacgtccctgtggtag

DBGET integrated database retrieval system