KEGG   Meriones unguiculatus (Mongolian gerbil): 110559567Help
Entry
110559567         CDS       T05884                                 

Gene name
Cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04260  Cardiac muscle contraction
mun04261  Adrenergic signaling in cardiomyocytes
mun04921  Oxytocin signaling pathway
mun05410  Hypertrophic cardiomyopathy (HCM)
mun05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110559567 (Cacng3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110559567 (Cacng3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110559567 (Cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    110559567 (Cacng3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    110559567 (Cacng3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    110559567 (Cacng3)
   05414 Dilated cardiomyopathy (DCM)
    110559567 (Cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mun04040]
    110559567 (Cacng3)
Ion channels [BR:mun04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110559567 (Cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 110559567
NCBI-ProteinID: XP_021510724
Position
Unknown
AA seq 315 aa AA seqDB search
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHSVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcaccaccgtaggagcctttgcagct
tttagtttaatgaccattgcagtgggcacggactactggctatattccagaggcgtgtgc
aggactaaatctacaagtgacaatgaaaccagcagaaagaatgaagaagtaatgacccac
tccgggttgtggaggacctgctgcttggaaggagcttttcgaggcgtgtgcaagaaaatt
gatcacttccctgaagatgcagactacgaacaagatacagcagaatatcttctacgggct
gtgagggcctccagtgtcttccccatcctcagcgtcaccttgctgttcttcggggggctc
tgcgtggccgccagcgagttccaccgcagcaggcacagtgttatcctcagtgcaggcatc
ttcttcgtctctgcagggctgagcaacatcatcgggatcatagtttatatttcagccaat
gctggagaccctgggcagagggactctaaaaagagctactcctacggctggtccttttat
tttggagccttctcgttcatcatcgcggaaattgtgggcgtggtcgccgtgcacatctac
atcgagaaacatcagcagttgcgtgccagatctcattcggagctcctgaagaagtctacc
ttcgcccgcctaccgccctacaggtataggttccgaagacggtcaagctcccgctccact
gagcccagatctcgagacctgtctcccatcagcaaaggcttccacaccatcccttccacc
gacatctccatgttcaccctctcccgggacccctcgaagctgaccatggggacccttctc
aactctgaccgggaccatgcttttctacagttccacaattccacacccaaagagttcaaa
gagtcgctgcataacaatccggccaacagacgtaccacgcctgtctga

DBGET integrated database retrieval system