KEGG   Meriones unguiculatus (Mongolian gerbil): 110560064Help
Entry
110560064         CDS       T05884                                 

Gene name
Myc
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04110  Cell cycle
mun04151  PI3K-Akt signaling pathway
mun04218  Cellular senescence
mun04310  Wnt signaling pathway
mun04350  TGF-beta signaling pathway
mun04390  Hippo signaling pathway
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04630  Jak-STAT signaling pathway
mun04919  Thyroid hormone signaling pathway
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05213  Endometrial cancer
mun05216  Thyroid cancer
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110560064 (Myc)
   04012 ErbB signaling pathway
    110560064 (Myc)
   04310 Wnt signaling pathway
    110560064 (Myc)
   04350 TGF-beta signaling pathway
    110560064 (Myc)
   04390 Hippo signaling pathway
    110560064 (Myc)
   04630 Jak-STAT signaling pathway
    110560064 (Myc)
   04151 PI3K-Akt signaling pathway
    110560064 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110560064 (Myc)
   04218 Cellular senescence
    110560064 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110560064 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110560064 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560064 (Myc)
   05202 Transcriptional misregulation in cancer
    110560064 (Myc)
   05206 MicroRNAs in cancer
    110560064 (Myc)
   05205 Proteoglycans in cancer
    110560064 (Myc)
   05230 Central carbon metabolism in cancer
    110560064 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110560064 (Myc)
   05225 Hepatocellular carcinoma
    110560064 (Myc)
   05226 Gastric cancer
    110560064 (Myc)
   05216 Thyroid cancer
    110560064 (Myc)
   05221 Acute myeloid leukemia
    110560064 (Myc)
   05220 Chronic myeloid leukemia
    110560064 (Myc)
   05219 Bladder cancer
    110560064 (Myc)
   05213 Endometrial cancer
    110560064 (Myc)
   05224 Breast cancer
    110560064 (Myc)
   05222 Small cell lung cancer
    110560064 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110560064 (Myc)
   05161 Hepatitis B
    110560064 (Myc)
   05160 Hepatitis C
    110560064 (Myc)
   05163 Human cytomegalovirus infection
    110560064 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110560064 (Myc)
   05169 Epstein-Barr virus infection
    110560064 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110560064 (Myc)
   03019 Messenger RNA biogenesis [BR:mun03019]
    110560064 (Myc)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    110560064 (Myc)
Messenger RNA biogenesis [BR:mun03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110560064 (Myc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH
Motif
Other DBs
NCBI-GeneID: 110560064
NCBI-ProteinID: XP_021511454
Position
Unknown
AA seq 439 aa AA seqDB search
MPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVTVAASFSPKEDDDGGGGNFSTADQLEMVTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSASPSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSSKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPARRSESGSSPSGGHSKPPHSPLVLKRC
HVSIHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEHKLTSEKDIL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtgagcttcgccaacaggaactatgacctcgactacgactctgtgcag
ccctatttcatctgcgacgaagaagagaatttctatcaccagcagcagcaaagcgagctg
cagccgcctgcgcccagtgaggatatctggaagaaattcgagctgctgcccaccccgcct
ctgtcccccagccgccgctccgggctctgttctccatcctacgttacggtcgctgcgtcc
ttctccccaaaggaggatgacgacggtggcggcggcaacttctccaccgccgatcagctg
gagatggtgacggagctacttggaggagacatggtgaaccagagtttcatctgcgatcct
gacgacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggcttctcc
gccgctgccaagctggtctcggagaagctggcttcctaccaggctgcgcgcaaagatagc
gccagcccgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgctgccgcgtctgagtgcatcgacccctcggtggtcttcccctacccgctc
aacgacagcagctcgtctaagtcctgtacctcgtccgattccacggccttctctccttcc
tccgactctctgctgtcctcggagtcctccccacgggccagccctgagcccctagtgctg
catgaggagacaccgcccaccaccagcagcgactccgaagaagaacaagaggatgaggag
gaaatcgatgtggtgtctgtggaaaagaggcagccccctgccaggaggtccgagtcaggg
tcatccccatcgggaggccacagcaaacctccccacagcccactggtcctcaagaggtgc
catgtctccattcatcagcacaattacgcagcaccgccctccacgaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaaacagatcagcaacaaccgc
aaatgtaccagccccaggtcctcagacacagaggaaaacgacaagaggcggacacacaac
gtcttggaacgtcagaggagaaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgagttggaaaacaatgaaaaggcccctaaggtagttatcctcaaaaaagccacc
gcctacatcctgtccatccaagcggaagagcacaagctcacctcagaaaaggacatactg
aggaagcggcgagaacagttgaaacacaaactcgaacagcttcgaaattctggtgcatga

DBGET integrated database retrieval system