KEGG   Meriones unguiculatus (Mongolian gerbil): 110560700Help
Entry
110560700         CDS       T05884                                 

Definition
(RefSeq) 3-alpha-hydroxysteroid dehydrogenase
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00140  Steroid hormone biosynthesis
mun00590  Arachidonic acid metabolism
mun00790  Folate biosynthesis
mun01100  Metabolic pathways
mun04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110560700
   00590 Arachidonic acid metabolism
    110560700
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110560700
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110560700
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     110560700
    1.1.1.188  prostaglandin-F synthase
     110560700
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     110560700
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     110560700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 110560700
NCBI-ProteinID: XP_021512382
Position
Unknown
AA seq 323 aa AA seqDB search
MYSVPLHVALNDGNFIPVLGFGTTVPEKVPKDEVIKATKIAIDAGFRHFDSAYLYKIEEE
VGQAIRSKITDGTVKREDIFYTSKLWSTFHRPELVRTCLEMTLKKTQLDYVDLYIIHFPM
SLQPGDEFFPQDEHGKVLADTVDLCDTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHLYLNQSKMLDYCKSKDITLVAYCTLGSSRDKKWVDQNSPVLLEDPV
LCAMAKKYKKTPALIALRYLLQRGIVVLARSFNEKRIKENMQVFEFQLASEDMKVLDGLD
RNLRYNTAFFFGEHPNQPFTDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtattctgtacctctgcatgtggcactaaatgatggtaacttcatccctgtactgggg
tttggaaccactgtgcctgagaaggttccaaaagatgaagttatcaaggctactaaaata
gctatagatgctgggttccgccattttgattcggcttatttgtacaaaattgaagaagaa
gtaggacaggccattagaagcaagattacagatggcactgtgaagcgagaagatatattc
tatacttcaaagctttggagcactttccatcgacccgaattggtccgaacttgcttggaa
atgacactgaagaaaacacaattggactatgttgatctttatattattcatttcccaatg
tctctgcagcctggagacgaattctttccacaagacgagcatgggaaagtgttggctgat
acagtggatctctgtgacacatgggaggccatggagaaatgtaaagatgcaggattggcc
aagtccattggggtgtccaactttaaccgcaggcagctggagatgatcctaaataagcca
gggctcaagtacaagcctgtgtgcaaccaagttgaatgccatctttatctcaaccagagc
aaaatgctggactattgtaagtcaaaagacatcactcttgttgcctactgcacattagga
agttcacgagacaaaaaatgggtggaccagaacagtccagttctcttagaagatccagtt
ctttgtgccatggccaaaaagtacaagaaaacaccagccctgattgcccttcgttacctt
ttgcagcgtgggattgtggttctggccaggagtttcaatgagaagcggatcaaagagaac
atgcaggtttttgaattccagttggcttcagaggacatgaaagtcctagatggcttagac
agaaatttaagatacaatactgcatttttctttggtgaacatcccaatcagccatttact
gatgaatattag

DBGET integrated database retrieval system