KEGG   Meriones unguiculatus (Mongolian gerbil): 110561307Help
Entry
110561307         CDS       T05884                                 

Gene name
Bmpr1b
Definition
(RefSeq) bone morphogenetic protein receptor type-1B isoform X1
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04350  TGF-beta signaling pathway
mun04360  Axon guidance
mun04390  Hippo signaling pathway
mun04550  Signaling pathways regulating pluripotency of stem cells
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110561307 (Bmpr1b)
   04390 Hippo signaling pathway
    110561307 (Bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561307 (Bmpr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110561307 (Bmpr1b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110561307 (Bmpr1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110561307 (Bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110561307 (Bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mun04090]
    110561307 (Bmpr1b)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110561307 (Bmpr1b)
Protein kinases [BR:mun01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110561307 (Bmpr1b)
CD molecules [BR:mun04090]
 Proteins
  110561307 (Bmpr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110561307
NCBI-ProteinID: XP_021513337
Position
Unknown
AA seq 521 aa AA seqDB search
MEVITMGICKGKLEKFTDNMLLRSSGKLNVGTKKEDGERTAPTPRPRILRCRCHHHCPED
SVNNICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNE
CNQDLHPTLPPLKNRDFVDGAIHHKALLISVTVCSLLLVLIILFCYFRYKRQEARPRYSI
GLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMG
KWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDY
HENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVK
KNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMY
SFGLILWEIARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDE
CLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcatcacaatgggaatatgcaaaggaaagttggagaagttcactgataacatg
ctcttaagaagctcgggaaaattaaatgtgggcaccaagaaagaggacggcgagaggaca
gcccccacccctcgccccaggatccttcgttgtagatgccaccaccactgtccggaggac
tcagtcaacaacatctgcagcacagatggatattgcttcacaatgatagaagaagacgac
tccggaatgcctgttgtcacctctggatgtctaggactagaagggtcagattttcaatgt
cgagacactcccattcctcatcagagaagatcaatcgaatgctgcacagagaggaatgaa
tgtaatcaagacctacaccctacattgcctccactgaagaacagagattttgttgacggc
gctatccaccacaaggccttacttatatctgtgactgtctgtagtttgctcttggtcctc
attattttattctgttactttaggtataaaagacaagaagccaggcctcggtacagcatt
gggctagagcaggatgaaacttacattcctcctggagagtccctgagagacttgattgag
cagtctcagagctcgggaagtggatcggggctccctctgctggtgcaaaggacgatagct
aagcaaattcagatggtgaagcagatcggaaaaggccgctatggggaagtgtggatgggc
aagtggcgtggagaaaaggtagctgtgaaagtgttctttaccacggaggaagccagctgg
ttccgcgagactgagatatatcagacagtcctgatgaggcacgaaaacattctggggttc
attgctgcggatatcaaagggactgggtcctggactcagttgtacctcatcacagactat
catgaaaatggttctctttatgactatctgaagtctaccacgctggatgcgaagtccatg
ctgaaattagcctactcttcagtcagcggcctatgccacttacacacggaaatcttcagc
actcaaggcaaaccagccatcgctcatcgagacctgaagagtaagaacatcctggtgaag
aaaaatgggacttgctgcatagcagacctgggtctggctgtcaagtttattagtgataca
aatgaggttgacatcccacccaacacccgggttggcaccaagcgctatatgcctccagaa
gtgctggatgagagcttgaacagaaatcacttccagtcttacatcatggctgacatgtac
agctttggactcatcctctgggagatcgcgaggagatgtgtttcaggaggtatagtagaa
gaataccagcttccgtatcatgacctggtgcccagtgacccttcttatgaggacatgaga
gaaattgtgtgcatcaagaagctacggccttccttccccaatcgatggagcagcgatgag
tgtctcaggcagatggggaagcttatgacagagtgctgggctcataatcctgcctccagg
ctgacggccctgcgagttaaaaaaacacttgccaaaatgtcagagtcccaggacattaag
ctctga

DBGET integrated database retrieval system