KEGG   Meriones unguiculatus (Mongolian gerbil): 110561819Help
Entry
110561819         CDS       T05884                                 

Gene name
Map4k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110561819 (Map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110561819
NCBI-ProteinID: XP_021514029
Position
Unknown
AA seq 1385 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPQPQPPPPPQ
PQPDRSKASYHAPEPRPPHYDPADRAREVEDRFRKTNHSSPEAQSKQTGRGAEPPVPSRS
ESFSSGNSESVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHHHLRSQ
DPCPPSRSEALSQSSDSKSEGPDPTQKAWSRSDTDEVPPRVPVRTTSRSPVLSRRDSPLQ
GSGQQNSQAGQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG
ERFRVRSSSKSEGSPSQRLENVAKKPEEKKEVFRPLKPAGEVDLTALAKELRAVEDVRPP
HKVTDYSSSSEESGTTDEEEEDGEQEGAEDSTSGPEDARAASSLNLSNGETESVKTMIVH
DDGESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTS
SSPSSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTT
VTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAAL
WGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYL
SWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKP
YHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQ
CSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTM
GWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRT
SLLSW
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactcccccgccaagagcctggtggacatcgacctctcgtccctgcgggac
cctgctgggattttcgagctggtggaagtggttggaaatggcacctacggacaagtctat
aaggggcgacatgtcaaaactgggcagctggcggccatcaaggttatggatgtcaccgag
gatgaagaggaagaaatcaaactggagataaatatgctgaagaaatattctcatcatagg
aatattgcaacgtactatggtgctttcattaaaaagagccctccgggacacgatgaccag
ctgtggcttgttatggagttctgtggggccgggtccatcacagaccttgtgaagaacacg
aaagggaacacactcaaagaagactggattgcttacatctccagagaaatcctcagggga
ctggcacatctccacattcaccacgttatccaccgagacatcaagggtcagaatgtgctg
ctgactgagaatgcggaggtgaagcttgttgacttcggcgtgagcgcccagctggacagg
acggtgggacgcaggaacacgttcatcggcacgccgtactggatggcccctgaggtcatc
gcctgcgatgagaaccccgacgccacctacgactacagaagtgacctttggtcttgcggc
atcacggccattgagatggcagaaggcgctccccctctctgtgacatgcatccaatgaga
gcgctgtttctcatccccagaaaccctcctcccaggctgaagtcaaaaaaatggtcaaag
aagttcttcagcttcatagagggctgcctggtgaagaactacatgcagcggccctcgaca
gagcagctgctgaagcaccctttcataagggatcagcccaatgagaggcaggttcgaatc
cagctgaaggatcatatagaccggaccagaaagaagagaggggagaaagatgaaaccgag
tatgagtacagtgggagtgaggaagaagaggaggaagtgcctgaacaggaaggagagcca
agctccatcgtcaacgtgcctggagagtctaccctgcgccgggatttcctgaggctgcag
caggagaacaaggagcgctccgaggccctgcgcaggcagcagcttctgcaggagcagcag
ctccgggagcaggaggagtataagaggcagctactggccgagcggcagaagcggattgag
cagcagaaggagcagaggcggcggctggaggagcaacagcggcgagagcgggaggccagg
aggcagcaggagcgcgagcagcggaggcgcgagcaggaggagaagaggcgcctggaggaa
ctggagcgcaggcgcaaggaggaggaggagcggaggcgggcggaggaggagaagaggaga
gtggagcgggagcaggagtacatcaggcggcagctggaggaggagcagcggcacctggag
atcctgcagcagcagctgctccaggagcaggccatgctactggagtgccgctggcgggag
atggaggagcaccggcaggcagagaggctccagaggcagttgcaacaagaacaagcatat
ctcctgtctctacagcacgaccacaggaggccgcagccgcagccgccgccgccgccgcag
ccgcagccggacaggagcaaagccagctaccatgctccagagcccaggcctcctcactat
gaccctgctgacagagcgcgcgaggtggaagatagatttagaaagactaaccacagctcc
cccgaggcccagtctaagcagacaggcagaggagccgagccgccggtgccgtcccggtca
gagtccttctccagcggcaactccgagtctgtgcaccccgccctgcagagaccagcggag
ccccaggtccagtggtcccacctggcatctctcaagaacaatgtttcccctgtgtcgagg
tcccattccttcagtgacccttctcctcccaaattcgcacaccaccatcttcgttctcag
gacccatgcccgccctcccgcagtgaggcgctcagtcagagctctgactctaagtcagag
ggacccgaccccacccaaaaggcgtggtctagatcagacactgacgaggtgcctccaagg
gttcccgtgagaacaacgtcccgctcccctgtcctgtcccgtcgggattccccactgcag
ggcagtggacagcagaatagccaagcaggacagagaaactctaccagcagtatcgagccc
cggctcctgtgggagagagtggaaaagctggttcccaggccaggcagcggcagctcctca
gggtccagcaactcaggatcccagcctggctcccaccctggctcccagagcggctccggt
gaacgcttcagagtgagatcgtcatccaagtctgaaggctcaccatcccagcgccttgaa
aatgtagccaaaaagcctgaagagaaaaaagaagtattccgacccctcaagcccgctggt
gaagtggacttgactgcgttggccaaagaactccgggcggtagaggacgtgcggccaccg
cacaaagtgaccgactactcgtcctccagtgaggagtctgggaccacggacgaggaggag
gaggacggggagcaggagggcgccgaggactccacctcaggcccggaggacgcccgagca
gcgtcgtctctgaatctgagcaacggtgaaacagaatctgtgaaaaccatgatcgttcat
gatgacggggagagtgagccggccatgaccccgtccaaggagggcacgctgattgtccgc
cagagtacagttgaccaaaagcgtgccagccatcatgagagcaatggctttgcggggcgc
attcacctcttgccagatctcttacagcaaagccattcctcctccacctcctccacctcc
tcctccccatcctccagccagccgacacccaccatgtccccacagacaccccaggacaag
ctcactgctaatgagactcagtccgctagtagcacactccagaaacacaaatcttcctcc
tcctttacaccttttatagaccccaggttactacagatttctccatctagtgggacgaca
gttacctctgtggtgggcttttcctgcgatggaatgaggccagaagccataaggcaagac
cctactcggaaaggctcagtggtcaatgtgaaccccaccaacactaggccacagagtgat
acccccgagatccgtaaatacaagaagaggtttaactcggagatactgtgtgctgcctta
tggggcgtgaatctgctggttggtacagagagcgggttgatgctcctggacagaagcggc
caagggaaagtgtacccgctgatcagccggagacgcttccagcaaatggatgtgctcgag
ggcctaaatgtcctggtgacgatatccggcaaaaaggataagttgcgtgtatactattta
tcctggttaagaaacaaaatccttcataatgaccctgaagtggagaagaagcaagggtgg
accacggtgggcgacctggaaggatgtgtgcactataaagttgtaaaatatgaaagaatc
aagtttctggtgattgctttaaagagttctgtggaagtctacgcgtgggcaccgaagcca
taccacaaattcatggcttttaagtcgtttggagaactggtccataagccattactggta
gatctcactgttgaggaaggccagaggttgaaagtgatctatggctcctgtgccggattc
catgctgtcgatgtggattcgggctcagtctacgacatttatctaccaacacacatccag
tgcagcatcaagccccacgcgatcatcatcctccccaacacggacggcatggagctcctg
gtgtgctacgaggatgagggggtgtacgtaaacacctatgggaggatcaccaaggacgtg
gttctgcagtggggcgagatgcccacctctgtagcgtatatccgatcgaatcagacaatg
ggctggggagagaaggccatagagatacgatctgtggaaaccggtcacttggatggcgtg
tttatgcacaaaagggctcagagactaaaattcttatgtgaacgcaatgacaaggtgttc
tttgcctccgtgcggtccgggggcagcagtcaggtttatttcatgaccttaggcaggact
tctctcctgagctggtag

DBGET integrated database retrieval system