KEGG   Meriones unguiculatus (Mongolian gerbil): 110561950Help
Entry
110561950         CDS       T05884                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL14
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mun03019]
    110561950
Enzymes [BR:mun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     110561950
Messenger RNA biogenesis [BR:mun03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     110561950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 110561950
NCBI-ProteinID: XP_021514225
Position
Unknown
AA seq 456 aa AA seqDB search
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTPAP
NSKRKCLDEGDTDEDKIEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIR
ELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFPPR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgcctgcaggagatccgggagcggcagaagctacggcggcagctcctagct
cagcagttgggagctgaaagtgcggatagcattggtgctgtgttaaatagcaaagatgag
cagagagaaattgctgagacaagagaaacttgcagggcttcttatgatacccctgctcca
aattcaaaacggaaatgcctggatgaaggagacacagatgaagacaaaatagaagaatat
aaggatgaactagaaatgcagcaggaggaagaaaatttgccatatgaagaagagatttac
aaagattcaagcacctttcttaagggaacgcagagcttaaatccccataatgattactgc
caacattttgtagacactggacatagacctcagaatttcatcagggacgtaggtttagct
gacagatttgaagaataccctaaacttagggaactcatcagactaaaggatgagttaata
gctaaatcaaatactcctcctatgtacttacaagccgatatagaagcgtttgacatcaga
gaattgacacccaaatttgatgtgattcttctggagcctcctttggaagagtactacaga
gagaccggcatcaccgcgaatgagaagtgctggacatgggacgatattatgaagttagaa
atcgatgagatcgcagcacctcggtcatttatcttcctctggtgcggttctggcgaagga
ctggacctgggaagagtatgtttgcgaaagtggggatacagaaggtgtgaagatatttgt
tggattaaaaccaataaaaacaatcccggaaagacgaagactctagatccaaaggcagtt
ttccagagaacaaaggaacattgccttatggggatcaaaggaactgtgaagcgaagcaca
gatggggatttcattcatgctaatgttgacattgacttaattatcacagaagaacctgaa
attggcaatatagaaaaacctgtagaaatttttcatataatagagcatttctgtcttgga
agacggcgtctgcatctgtttgggagagacagtactatcaggccaggctggctcacagtt
ggaccaacacttacaaatagtaactacaatgcagaaacatatgcgtcctatttcagtgcc
cctaattcgtacttgactggctgcacggaggaaatcgagaggcttagacccaagtcgcct
cctcccaagtccaagtctgacagaggcggtggagctcccagaggtggaggacgaggggga
acttctgccggccgaggtcgggaaagaaatcgatccaatttccgaggagaaagaggtggc
tttagggggggtcgtggaggcacacacagagggggctttccacctcggtaa

DBGET integrated database retrieval system