KEGG   Meriones unguiculatus (Mongolian gerbil): 110562171Help
Entry
110562171         CDS       T05884                                 

Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00500  Starch and sucrose metabolism
mun01100  Metabolic pathways
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04910  Insulin signaling pathway
mun04922  Glucagon signaling pathway
mun04931  Insulin resistance
Module
mun_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110562171
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110562171
   04152 AMPK signaling pathway
    110562171
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110562171
   04922 Glucagon signaling pathway
    110562171
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110562171
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110562171
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     110562171
Glycosyltransferases [BR:mun01003]
 Polysaccharide
  Storage polysaccharide
   110562171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 110562171
NCBI-ProteinID: XP_021514546
Position
Unknown
AA seq 704 aa AA seqDB search
MLRGRSLSVTSLGGLPVWEAERLPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPNNDAVRKAMDAMNKHGCQVHFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKHIIAQFH
EWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNQLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAVEAEHMLKRKPDVVTPNGLSVKRFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHSMKEKFGKKLYDGLLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPAAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHLEPISPPTTDGFKYPRPSSVPPSPLGSQNSSPQSSDVE
DEGDEDERYDEEEEAERDRLNIKSPFSLNHVPKGKKKLHGEYKN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaggccggtccctgtccgtgacttccctcggcggactccctgtatgggaagct
gaaagactccccgtggaagatctactgctttttgaagtttcctgggaggtgaccaacaaa
gttgggggcatctatactgtgattcagaccaaggccaaaacaacagcagacgaatgggga
gaaaactatttcctgataggtccatattttgagcacaatatgaagacgcaagtggaacag
tgtgagcccaacaatgatgctgtcaggaaagccatggatgcaatgaataaacatggctgc
caggtgcattttggaagatggctgatagaagggagtccctacgtggtgctctttgacata
agctcctctgcatggaatctggacaggtggaagggtgacttctgggaagcatgcggtgtt
ggcattcctcatcatgaccgagaagccaacgacatgctcatatttgggtctttaactgcc
tggttcttaaaagaggtgaccgaccatgcagacggcaaacacatcattgcccaattccat
gaatggcaggcaggcaccgggctcatcctgtcccgtgccaggaaactccccatcgccacg
gtgtttacgacccatgccacgctgcttgggcggtacctctgtgccgcaaacattgacttc
tacaaccagctcgacaagttcaacatagacaaagaggcgggggaaaggcagatttatcac
cgctactgcatggaacgggcctctgtgcactgcgcccacgtgttcaccaccgtgtcagag
atcacagccgttgaggcggagcacatgctgaagaggaagcctgatgtagtgactccaaat
ggcttgagtgttaagaggttttctgcagtgcatgaatttcaaaatcttcacgccatgtac
aaggccagaatccaggactttgttcgaggtcatttttatggtcatttggactttgatctt
gagaagactttattccttttcattgctgggaggtatgagttctcaaacaaaggagcagac
atcttccttgaatctttatccaggctcaatttccttctaaggatgcacaagagtaacgtc
actgtcgtggtgtttttcatcatgcctgccaagacaaacaatttcaacgtggaaaccttg
aagggccaggctgtgcggaaacagctgtgggacactgtgcattctatgaaagaaaagttt
ggaaagaaactctacgatgggttattgagaggagaaattcctgacatgaacaatattttg
gatcgagatgacttaacaattatgaaaagagccattttttctactcagagacagtctttg
cctcctgtgaccactcacaacatgatcgatgactccacggatcccatcctcagcaccatt
agacgaatcggactcttcaacaatcgtgcagacagagtcaaggtgattttacacccagaa
tttctgtcctccaccagccccctactacccatggattatgaagaatttgtccgaggttgt
catcttggggtgttcccatcatactatgaaccgtggggttacactccagctgaatgcacc
gtgatgggcatccctagcgtgaccacaaacctctcggggtttgggtgtttcatgcaggag
cacgtggctgaccccgctgcctacggcatttacattgtcgacaggcgcttccgctccccg
gatgattcttgcaatcagctgacgcagtttctctatgggttttgcaaacagtcacgccgt
caaagaatcatccagaggaaccgcacggagaggctctcggatcttctggactggagatac
ctgggcagatattaccagcacgccagacacctgacactaagcagggcttttcctgacaaa
ttccacctggagcccatatcaccaccaacgacggatgggtttaagtaccccaggccctcc
tcagtaccaccttctccactgggatctcagaactccagtcctcagagcagtgatgtggaa
gatgaaggagatgaggatgaaaggtatgatgaggaagaggaggccgagagggatcggtta
aacatcaagtcaccgttttctctgaaccacgttccaaaggggaagaaaaagcttcatggg
gaatataagaactga

DBGET integrated database retrieval system