KEGG   Meriones unguiculatus (Mongolian gerbil): 110562929Help
Entry
110562929         CDS       T05884                                 

Gene name
Minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00010  Glycolysis / Gluconeogenesis
mun00562  Inositol phosphate metabolism
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110562929 (Minpp1)
   00562 Inositol phosphate metabolism
    110562929 (Minpp1)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110562929 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110562929 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 His_Phos_1
Motif
Other DBs
NCBI-GeneID: 110562929
NCBI-ProteinID: XP_021515510
Position
Unknown
AA seq 479 aa AA seqDB search
MLRGACSRPRASVAPAAVLAGALLSSFARCSLPGRGDPVASALSPYFGTKTRYEDVNPWV
LLDPVAPRRDPGLLPGTCTPVQLVALIRHGTRYPTTKQIRKLRQMQGLLETRGDGGSRVA
AALAERTLWYQDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENFGRLRLVTSSKHRCV
DSSAAFLEALWQRYHPGVPPPDVSDMECDPPRINDKLMRFFDHCEKFLTDVERNATALYH
VEAFKTGPEMQKILKKVAATLQVPVNKLNADLLQVAFFTCSFDLAIKGMHSPWCDVFDIE
DAKVLEYLNDLKQYWKRSYGYTINSRSSCSLFQDIFLHLDKAVEQKQRSQPVSSPVILQF
GHAETLLPLLSLMGYFKDKEPLTAFNFEEQGHRQFRSGHIVPYAANLIFVLYHCEDAKTP
REEFQVQVLLNEKVLPLAYSQEPAALYEDLKHHYRDILQSCQTSKECDLPKVNITSDEL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcggcgcgtgcagccgcccgcgcgcctcggtggcacccgccgcggtcctggct
ggggcgctgctctcgtcgttcgcgcgctgctctctcccgggccgcggcgacccggtggcc
tcggcgctcagcccctacttcggcacgaagactcgctacgaagatgtcaacccctgggtg
ctgctcgacccggtggcgccgcggcgggacccggggctgctgccggggacctgcaccccg
gtgcagctggtcgccctcatccgccacggcacccgctaccccacgaccaagcagatccgc
aagctgaggcagatgcaggggctgctggagacccgcggggacggcgggagccgagtggcc
gccgcgctggccgagcggacgctgtggtaccaggactggatggacgggcagctggtggag
aaggggcggcaggacatgcgacagctggcactgcgcctggccgccctcttcccagacctc
ttcagccgggagaacttcggccgcctgcggctggtcaccagctccaagcaccgctgtgtg
gacagcagcgccgccttcctcgaagcgctgtggcagcgctaccaccccggagtgccgccg
ccggacgtctcagatatggagtgtgaccctccaagaattaatgataaactaatgaggttc
tttgatcattgtgagaagtttttaactgatgtggaaagaaatgctacagctctttatcat
gtggaagccttcaaaactggacctgaaatgcagaagattttaaagaaagttgcagctact
ttgcaagtaccagtaaacaagttaaatgcagacttacttcaggtagccttcttcacctgt
tcctttgacttggcgattaagggcatgcattctccctggtgtgatgtgtttgacatagaa
gatgcaaaggtactggaatacttaaacgatctgaaacagtattggaaacgaagttatggc
tataccattaacagtcggtccagctgcagcctgtttcaggatatcttcctacacctggac
aaagcagttgagcagaagcaaaggtctcagccagtctcttctccagtcatactccagttt
ggtcatgcagagaccctcctgccactgctgtctctcatgggctacttcaaagacaaggag
cctctgacagcgttcaattttgaggagcaaggccaccgccagttccggagtggtcacatc
gtgccgtatgccgcaaacctcatattcgtgctataccactgtgaagacgcaaagacccct
agggaagagttccaggtgcaggtgctgctgaatgagaaggtgttacccctggcctactca
caagaacctgctgctctgtatgaggatctgaagcaccactacagggacattcttcagagc
tgtcagaccagcaaggagtgtgacctacccaaggtgaacatcacatccgatgagctctga

DBGET integrated database retrieval system