KEGG   Meriones unguiculatus (Mongolian gerbil): 110563162
Entry
110563162         CDS       T05884                                 

Gene name
Rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110563162 (Rdh5)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110563162 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 110563162
NCBI-ProteinID: XP_021515834
Position
Unknown
AA seq 318 aa
MWLPLFLGALLWAMVWLLRDRQRLPASDAFIFITGCDSGFGRLLALQLDQKGFQVLASCL
TPSGAEDLQQMASSRLHTTLLDVTDPENVQQVAKWVKTHVGEAGLFGLVNNAGVAGIMGP
TPWLTQDDFQRVLSVNTLGPIGVTLALLPLLQQARGRVVNVTSFLGRLAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGCFRTPVTNLESLENTLKACWARLPPATQAHYGET
FLTAYLQVQRRLLNLACDPDLTKVTGCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
LVDAVLTWVLPRPARSIY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgttcctgggtgccttgctgtgggcaatggtgtggttgctcagagac
cggcagaggctgcctgccagcgatgccttcatcttcatcactggctgtgactcgggcttt
ggtcgccttctggcactgcaacttgaccagaagggcttccaagtcctggccagctgcctg
accccctctggggctgaggacctacagcagatggcctcctcccgcctgcacacaacactg
ctggatgtcaccgatcctgagaacgtccagcaggttgccaagtgggtgaagacacatgtt
ggagaagctgggctctttggtctggtgaataatgctggtgtcgctggtatcatggggccc
acgccatggctgacacaggacgatttccagcgagtgctgagcgtgaacacactgggtcct
attggggtcacccttgccctgctgcccctactacagcaggcccggggccgggtggtcaat
gtcaccagcttcttgggtcgcctagcagccaatggggggggctactgtgtttctaagttt
ggcctggaggccttctccgacagcctgaggcgggacatggctccattcggagtacaagtc
tccattgtggaacctggctgcttccgaacccctgtgaccaacctggagagcctggagaac
accctgaaggcgtgttgggcccgactgcctccagctacacaggcccactatggggaaact
ttcctcactgcttatctgcaagtgcagcgccgcctcttgaacctggcctgtgacccagac
cttacgaaggtgacaggctgcctggagcacgccctgactgcgcgtcacccccgaacccgc
tacagccccggctgggatgccaagctgctctggctgcctgcctcctaccttccagccagg
cttgtggatgctgtgctcacctgggtccttccccggcccgcccggtcaatctactga

DBGET integrated database retrieval system