KEGG   Meriones unguiculatus (Mongolian gerbil): 110563412Help
Entry
110563412         CDS       T05884                                 

Gene name
Hnmt
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00340  Histidine metabolism
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    110563412 (Hnmt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110563412 (Hnmt)
Enzymes [BR:mun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     110563412 (Hnmt)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110563412 (Hnmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 110563412
NCBI-ProteinID: XP_021516151
Position
Unknown
AA seq 293 aa AA seqDB search
MASCMRSLFSDHSRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGETKAEMKILSVG
GGAGEIDLQILSKVQAQYPGICIHNEVVEPSAEQIVKYKELVAKTSNMENIKFAWHKETS
SEYQKRVLGEEPQKWDFIHMIQMLYYVKDIPATLRFFHGLLAANAKILIILVSGTSGWDK
LWKKYGSRLPRDDLCQYVTSSDLAQMLDDLGIKYECYDLLSTMDITDCFIDGNENGELLW
DFLTETCNFSKTAPPDLKAEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEAHV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttgcatgaggagcttgttttctgaccacagcagatacgttgaatcttttcgg
aggttcctaaataattccacggaacaccagtgcatgcaggaattcatggacaagaagctg
ccaggcataatagcaagaattggagaaacaaaagcagaaatgaagattctgagcgtaggt
ggaggtgcaggtgaaattgaccttcaaattctctccaaagtccaggctcaatacccagga
atctgtatacacaatgaagttgttgaaccaagtgctgaacaaattgtcaagtacaaagag
cttgttgccaagacatcaaacatggagaacataaaatttgcttggcacaaggagacatca
tctgaatatcaaaaacgtgtgctgggagaagagcctcaaaagtgggacttcattcatatg
attcagatgctgtattatgtgaaggatattccagctaccctgagattcttccatggtctc
ttagctgccaatgctaaaattctcattattcttgtatcaggcactagtggctgggacaag
ctatggaaaaagtacggctcccgcctacccagggatgacctctgccagtatgtcacatcc
tctgatctcgctcagatgctggatgacctggggattaagtatgagtgctatgaccttttg
tccaccatggacataacagactgttttattgatggtaatgaaaatggagaactgctttgg
gattttttaacagaaacctgcaactttagcaaaacagcaccaccagatctcaaagcagaa
atcatgaaagatcttcaagagcctgaatttagtgttaagaaggaggggaaggtacttttt
aacaataatctgagttttatagtggttgaggcacatgtataa

DBGET integrated database retrieval system