KEGG   Meriones unguiculatus (Mongolian gerbil): 110563431Help
Entry
110563431         CDS       T05884                                 

Gene name
Qsox1
Definition
(RefSeq) sulfhydryl oxidase 1 isoform X1
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110563431 (Qsox1)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     110563431 (Qsox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_SOX QSOX_Trx1 Evr1_Alr Thioredoxin Thioredoxin_2 Thioredoxin_8 DUF35_N OST3_OST6
Motif
Other DBs
NCBI-GeneID: 110563431
NCBI-ProteinID: XP_021516185
Position
Unknown
AA seq 748 aa AA seqDB search
MRRCGRRSGPPSLLLLLLPPLLLAVPGAGAARLSVLYSSSDPLTLLDADTVRPAVLGSSS
AWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCADESNSDVCREFNIAGFP
TVRFFKAFSKNGSGTALPAAGANVQTLRRRLIDALESHRDTWPLACPPLEPAKLKEINEF
FVRNNTEYLALIFERKDSYVGREVTLDLSQYHTVAVRRVLNTESDVVSKFGVTDFPSCYL
LFRNGSVSRVPVMVESRPFYTAYLQGLSGLPREAPPTTAAPVTPKEVAPTVWKFADRSKI
YMADLESALHYIFRVEVGKFSVLEGQRLVALKKLVAVLAKYFPGQPLVQNFLHSINDWLQ
KQQKKKIPYSFFKAALDSRKEGFVLAEKANWVGCQGSEPHFRGFPCSLWVLFHFLTVQAH
RHSENHPQEPADGQEVLQAMRSYVRYFFGCRDCADHFEQMAAASMHKVGSPSSAVLWLWT
SHNRVNARLSGALSEDPHFPKVQWPPRELCSACHNELNSQVPVWDQGATFNFLKAHFSPA
NIIIDPPAAGPAAQSGAQNPEAKPELVMDAAELETRNSVLGHEWAASAEPPGATALAGPS
ENPGAIDPQELHTGLRMSGAPPGQGPPAHVQELPGAVQENAQGQQHLSERDTEALLLPEV
NHLQGSLELRRGGRSPKQLASILEGEPEALDRQGQGQWLQVLGGDFSHLDISLCVGLYSV
SFMGLLAMYTYFRARIWILKGHASHPTA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggtgcggccgccgctcggggccgccgtctctgttgctgctgctgctcccgccg
ctgctgctcgcggtgcccggcgctggcgcggcccggctctcggtgctctattcgtcctcg
gacccgctgactctgctggatgccgacaccgtgcgcccggctgtgctcggctccagcagc
gcctgggcggtggagttcttcgcctcctggtgcgggcactgcattgccttcgctccgacg
tggaaggagctcgccaacgacgtgaaggactggaggccagcattgaatcttgctgtcctg
gactgtgctgatgagtccaacagcgacgtctgcagagaattcaacatcgctggcttccca
actgtgaggttttttaaggccttttccaagaatggttctggaacagcattaccagcggct
ggtgctaacgtgcagacgctgcgtaggcggctcattgatgctctggagtcccaccgtgac
acgtggcccctagcctgtccacccctggagcctgccaagctgaaggagatcaatgaattc
tttgtaagaaataatacagagtacctggccctgatctttgaaagaaaagattcctacgtg
ggtagagaggtaactctggacctgtcccagtaccacactgtggcagtgcgcagggtcttg
aatacagagagcgacgtggtgagcaagtttggtgtcactgactttccatcttgctacctg
ctgtttcggaatggctctgtctcccgagtgcctgtgatggtggagtccaggcctttctat
acagcctacctgcagggcctgtcgggactgcctagggaggctcccccaaccacagccgca
ccagtgactcctaaggaagtagcacccacagtgtggaagtttgcagaccggtccaagatc
tacatggccgacctggagtctgcactgcactacatctttcgtgtagaagtgggaaagttc
tcagttctggagggacagcgcctggtggccctgaaaaagcttgtggcagtcttggccaag
tacttccctgggcagcctttggtccagaacttcttgcactcgataaacgactggctgcag
aagcagcagaagaagaagatcccctatagcttcttcaaagctgctctggacagcaggaag
gagggcttcgttcttgctgagaaggcgaactgggttggctgccagggcagtgagccacat
ttccggggcttcccctgctccctgtgggtcctcttccacttcctgactgtgcaggcacac
aggcacagtgaaaaccacccacaagaaccagctgatggccaggaggtccttcaggccatg
cgaagctatgtccggtacttctttggctgtcgtgactgtgctgaccattttgagcagatg
gcggccgcctccatgcacaaggtgggaagtcccagtagtgcagtcctctggctctggact
agccacaacagggttaacgctcgcctctcaggtgctctgagtgaggacccccacttcccc
aaggttcagtggccaccacgtgagctctgttctgcctgccataacgaactcaacagccag
gtgcctgtgtgggaccaaggtgccaccttcaactttctcaaggctcacttctccccagca
aacatcatcatagaccctcctgcagctggacccgcagcccagagtggtgcccagaaccca
gaagccaaaccagagctggtaatggatgcagcagagctagagaccagaaactcagtgctg
ggccacgagtgggctgcttctgcagagcccccaggagccactgccctagccggtccctct
gagaatcctggagcaattgacccccaggaactacacacaggcctcagaatgagtggagcg
ccaccagggcagggccctcctgcccatgtgcaggagcttccaggggctgtgcaggagaat
gcccaggggcagcaacacttgagcgagagagacactgaggccttactgctgcctgaggtg
aaccacctccaaggctctttagagctaaggcgagggggccgcagccccaagcagctagcc
agcatacttgaaggggagccagaggccctagatagacagggccaaggccagtggctgcag
gttctgggtggagacttttcccacctggacattagtctctgtgtggggctctactctgtg
tccttcatgggcttactagccatgtacacctacttccgggccaggatatggatcctgaag
ggccatgccagtcaccccacagcctga

DBGET integrated database retrieval system