KEGG   Meriones unguiculatus (Mongolian gerbil): 110563733Help
Entry
110563733         CDS       T05884                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00140  Steroid hormone biosynthesis
mun01100  Metabolic pathways
mun04913  Ovarian steroidogenesis
mun04925  Aldosterone synthesis and secretion
mun04927  Cortisol synthesis and secretion
mun04934  Cushing syndrome
Module
mun_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
mun_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110563733
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110563733
   04925 Aldosterone synthesis and secretion
    110563733
   04927 Cortisol synthesis and secretion
    110563733
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110563733
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     110563733
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     110563733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 KR RmlD_sub_bind Ldh_1_N NmrA Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-GeneID: 110563733
NCBI-ProteinID: XP_021516586
Position
Unknown
AA seq 379 aa AA seqDB search
MPGWSCLVTGAGGFLGKRIVHMLLQEKDLEEIRVLDKVFRPETRKDFFNLKTSTKVSVLE
GDILDAQYLRRACQGISVVIHTAAVIDVSGVIPRQTILDVNLKGTKNLLEACVQTSVPVF
IFTSSVDVAGPNSYKQIILDGHEEDNLESTWSDPYPYSKKMAEKAVLAANGCTLRNGGTL
HTCALRPMYIYGEKSSFLYNTVTCALKNKGVLDTTGKYSRANPVYVDNVAWAHILAARGL
RDPKKSPSIQGQFYYISDDTPHQSYDDLNYTLSKEWGLRPDSSWSLPLPLLYWLAFLLET
VSFLLSPVYSYRPVYSYRPPFTCHLVTLSNSTFAFSYKKAQHDLGYEPCVTWEEAKQKTS
EWIGTLVEQHKETVNSKTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtggagctgcctggtgactggagcaggagggtttctgggcaaaagaatcgtc
cacatgctgctgcaggagaaagatctggaggagatcagagtcctggacaaggtcttcaga
ccagaaaccaggaaagatttcttcaacctcaaaacaagcacaaaggtgtcagtgctggag
ggagacattctggatgcccagtacctgaggagagcctgccagggcatctctgtggtcatc
cacactgctgctgtcattgatgtctcaggggtcattcccagacagaccatcctagatgtc
aatctgaaaggtaccaagaacctattggaggcctgtgtccaaactagtgtgccagtcttc
atcttcaccagctcagttgatgtggcagggcccaactcctataagcagatcatcttggat
ggccatgaagaagacaatctagaaagtacatggtctgatccatatccatacagcaaaaag
atggctgagaaggcagtgttggcagccaatgggtgcaccctgagaaatggtggcacttta
catacttgtgccttaaggcccatgtacatttatggggaaaaaagctcattcctttataac
acagtaacttgtgctctgaaaaataagggtgttttggatactactggcaaatactctaga
gccaacccagtgtatgtggacaacgttgcctgggcacacattctggctgccaggggccta
cgcgaccccaagaagtcacccagcatccaaggtcagttctactacatctcagatgacacc
cctcaccaaagctatgatgacttaaattacaccctgagcaaggaatggggcctccgccct
gattccagttggagccttcctctgcccctgctctactggcttgccttcctgctggaaact
gtgagcttcctgctgagtccagtctacagctaccgtccagtctacagctaccggcccccc
tttacctgccacttggttacgctgtccaacagcacgtttgccttctcctacaagaaagcc
cagcacgatctcggctatgagccgtgtgtcacctgggaggaagccaagcagaaaacctca
gagtggatcgggacactagtggaacagcacaaggaaacagtgaactcaaagactcggtga

DBGET integrated database retrieval system