KEGG   Meriones unguiculatus (Mongolian gerbil): 110564518Help
Entry
110564518         CDS       T05884                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00232  Caffeine metabolism
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110564518
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110564518
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110564518
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110564518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Imm26
Motif
Other DBs
NCBI-GeneID: 110564518
NCBI-ProteinID: XP_021517664
Position
Unknown
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNLEDKLDLDTLTEILQHQIHAVPFENLNMHCGEAMDIGLEAIFDQIV
RKKRGGWCLQINHLLYWALTKMGFETTMLGGYFYITPTSKYSSEMVHLLVQVTISDRNYI
VDSACGCSYQIWKPLELTSGKDQPQVPAIFRLTEENGTWYLDQIRREHYIPNEEFVNSDL
LDKNKYRKIYSFTLEPRTIEDFVHVNTYLQTSSTSVFVSTSVCSLQTSEGVSCLVGFTFM
SRKFSYKDNVDLVEFKKVNEDEMEDVLKTTFGISLERKFVPKHGKLSFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatactttgaaaggattggttataagaacttagaggataaactggac
ttggacacattaactgaaattcttcagcaccagatacatgcggttccttttgagaatctt
aacatgcattgtggagaagccatggatattggcttagaggccatttttgaccagatagta
aggaagaagcggggtggttggtgtctccagattaatcatctgctgtactgggctctgacc
aaaatgggctttgaaaccacaatgttgggaggatacttttacataactccaaccagcaaa
tacagcagtgaaatggtccaccttctggtacaggtgaccatcagtgacaggaactacatc
gtggattctgcctgtggatgctcctaccagatatggaagcctctggaattaacatcaggg
aaggatcagcctcaggtgcctgccatcttccgtttgacagaagagaatggaacctggtac
ttggaccaaatcagaagagagcactacattccaaatgaggaatttgttaactcagacctc
cttgacaagaacaaatatcgaaaaatctattcctttactcttgaaccccgcactattgag
gattttgtacatgtgaatacctaccttcagacatcatcaacctctgtttttgtaagcaca
tcagtttgttccttgcagacatcagaaggggtttcctgtttagtaggcttcacctttatg
agtaggaaattcagttacaaggacaacgtagatctggtcgagtttaagaaggtgaacgag
gacgaaatggaagatgtactgaaaactacatttggcatttctttggagagaaagtttgtg
cccaaacatggtaaactatcttttactatttag

DBGET integrated database retrieval system