KEGG   Meriones unguiculatus (Mongolian gerbil): 110564564Help
Entry
110564564         CDS       T05884                                 

Gene name
St3gal6
Definition
(RefSeq) type 2 lactosamine alpha-2,3-sialyltransferase
  KO
K03792  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.6]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    110564564 (St3gal6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mun01003]
    110564564 (St3gal6)
Enzymes [BR:mun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     110564564 (St3gal6)
Glycosyltransferases [BR:mun01003]
 Terminal extension
  Sialyltransferase
   110564564 (St3gal6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 110564564
NCBI-ProteinID: XP_021517721
Position
Unknown
AA seq 333 aa AA seqDB search
MRGYLVVIFLSSIFLYYLLHCILWRTNDYGVSPLDLIKTNKSNIQYCKKKPPFISLLRFP
RFYPFLCAGDFEKSTYAYSSRNFALPYGTKISGGFFRAVLSLLPSCDVFDEFDKVPCKKC
VVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPTQN
DPNTTAVLIAFKPQDLRWLIEILTGSKIATDGFWKQPALNLIYNRSQIRILDPYITREAA
YHFLHFPKVFPKDQKPKHPTTGIIAITMAFHICSEVHLAGFKYNFLSPNSPLHYYGNATM
ALMKQNAYHNVAAEQLFLTNIIKKKMVINLTQD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagagggtacctggtggttatattcttgagttccatcttcctctattatctactacat
tgtatcctgtggagaacaaatgactatggggtctcacctctggatttaataaagacgaat
aaaagcaatatccagtattgtaaaaaaaagccacctttcatctctctcctgaggtttcct
cgattttacccatttctgtgtgcaggtgattttgaaaagtctacttacgcgtacagtagc
cggaactttgctttgccctacggcacaaagatatcaggaggattttttcgtgctgtcctt
tcactactgccgagttgtgatgtctttgatgagtttgacaaagtgccctgtaaaaagtgt
gtggtggttggaaatggaggcgtgttgaagaacaagacactaggtgcaaagatcgactcg
tatgatgtaataataaggatgaataatggtcctgttttaggacatgaagaggaagttggg
agaaggacgaccttcaggcttttttatccagagtctgtcttttcagatcctactcaaaat
gatcccaatactacagctgttctcattgcttttaagccacaggatttaaggtggctgata
gaaatactgacaggtagcaaaatagccactgatggtttttggaagcaaccagccttgaac
ctgatctataatcgatctcaaatcagaatattagatccatatattaccagagaagcagct
tatcactttcttcattttcccaaagtgtttcccaaagatcagaaacccaaacaccccacg
acaggaattatcgccatcacaatggcgtttcacatatgcagtgaagtccacctcgctggt
ttcaagtacaacttcctcagtccaaacagtcctttacactactatggaaatgccaccatg
gctttgatgaaacagaacgcttatcacaatgtggctgcagaacagctctttttaacaaat
attataaagaagaaaatggtaatcaacctaactcaagattga

DBGET integrated database retrieval system