KEGG   Meriones unguiculatus (Mongolian gerbil): 110564581Help
Entry
110564581         CDS       T05884                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110564581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 Elong_Iki1 TEA
Motif
Other DBs
NCBI-GeneID: 110564581
NCBI-ProteinID: XP_021517738
Position
Unknown
AA seq 1391 aa AA seqDB search
MKWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLESE
LKSSISALSSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLH
KNLEGNHDQHGRNNLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASL
NLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGPKAAPWGSNPSPSAE
STQLFHEELALQWVVCSGGVRESALQQAWFFFELMVKSMMHHLYLNDKLDAPRKTRFPER
FLDDIAALVSTIAGDVVTRFQKDTEMVERLNTSLAFFLNDLLSVMDRGFVFSLIKSCYKQ
VTTKLYSLPNPSVLVSLRLDFLRIICSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSG
FSTNVQDQKTANMFELSLPFRQQHYLAGLVLTELALILDPDAEGLFGLHKKVINMVHNLL
SSHDSDPRYSDPQIKARVAMLYLPLIGIIMETVPQLYDFTETHNQRGRPVCIAPDDYDSE
SGSMISQTVAMAIAGTSVPQLTRPGSFLLTSTSGRQHTTFSAESSRSLLICLLWVLKNAD
ESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMNSLTFKKSKDMRAKLEEAI
LGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHEA
LIDGNLATEANLIILDTLEIVVQTVSVTESKESILGGVLKVLLQSMACNQSAVYLQHCFA
TQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLLMRQNFEIGNN
FARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNL
HMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQ
CLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYF
TESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIV
HQSTGWERMFGTYFRVGFYGTKFGDLDEQEFIYKEPAITKLAEISHRLEGFYGERFGEDV
VEVIKDSNPVDKCKLDPNKAYIQITYVEPFFDTYEMKDRVTYFDKNYNLRRFVYCTPFTL
DGRAHGGLREQRKRKALLTTSHAFPYIKTRVHVTHKEEIILTPIEVAIEDMQKKTQELAF
ATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPGDPKLFRHHNKLRLCFKDFT
KRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDS
FSRMSLRKMEL
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggtagataaccacaaaggagtatttaatgttgaagttgttgctgtttcgtcc
attcacacacaagatccttatcttgacaaattctttgctcttgtcaacgctctggatgaa
cacatgttcccggtccgaattggggacatgcggatcatggaaaacaacttagagagtgag
ctcaaaagtagcatctcagccttgagttcctcacagctagaacccgtggtccggtttctt
catcttctgcttgacaaactgatacttttagttgttagaccacctgtgattgccggccaa
atagttaatctagggcaagcatcttttgaagctatggcatcaattataaatcgacttcac
aaaaacttagaaggaaaccatgaccagcatggcaggaacaaccttctcgcatcgtacatc
tattacgtgttccgcctgccaaatacttaccctaactccccgtcaccaggccctgggggt
ttgggaggatcagtgcactatgccacaatggccaggtctgcggtgaggccggcaagcctt
aacttaaatcgttctcgaagccttagcaacagtaatccggatatatctgggactcccacc
tcaccggatgatgaagttcggtcaatcattggcagtaagggtttagaccgctccaattcc
tgggttaacactggtccaaaagctgccccatggggatccaaccccagtccaagtgcagag
tcaacacagctttttcacgaggaactggctctgcagtgggtcgtttgcagtggcggcgtg
cgggagtcagctttgcagcaagcctggttcttttttgagttgatggtaaagagcatgatg
caccacttgtatcttaatgacaagcttgatgcgccaaggaaaacccgctttccagaacgc
ttcctggatgacatcgctgccctcgtcagcacaattgctggtgacgtcgtgacacgattc
cagaaggacacagaaatggttgagagactcaatacaagccttgccttctttctcaatgat
ctgttgtctgttatggacagaggttttgtcttttcccttataaagtcctgctacaaacag
gtgacaacaaagctctattcgctgccaaatccgagtgtcctggtgtccttgaggttggac
ttcctgcgaatcatctgcagccatgagcactatgttacattaaacctaccctgcagcttg
ctcaccccgcccgcatctccgtccccttctgtttcttctgcaacatctcagagttccgga
ttttccacaaatgtgcaggaccagaagactgcaaacatgtttgaactgtccctgcccttc
cgccagcagcattacctggccggcctcgtgttgacggaacttgcactcattttagacccg
gatgctgaaggactgtttggattgcataagaaagtcatcaatatggtacacaacttactg
tccagtcacgactctgacccacggtactctgaccctcagataaaggctcgggtggccatg
ttgtacctccctctgattggtatcatcatggaaactgtgcctcaactgtacgattttaca
gaaacacacaatcaacgaggaaggccagtttgtatagcccccgatgactacgatagtgag
agtgggagcatgataagccagacagttgccatggcaattgcaggaacatcagtccctcag
ctaacaaggcctggcagtttcctgctcacttcaacgagtggcaggcagcataccaccttc
tcggcggaatcaagccggagccttttgatctgtctgctgtgggtgctcaagaacgccgat
gagtcagttctgcagaagtggttcaccgacctctcggtcctccaactgaaccggctgtta
gatctgctttatctgtgtgtatcttgctttgagtacaaagggaaaaaggtgtttgaaaga
atgaatagtttaacctttaagaaatcaaaagacatgagagccaagcttgaagaagccatt
ctggggagcatcggtgccaggcaggaaatggtacggcggagccgagggcagctcgagagg
agcccatctggaagtgcctttgggagccaggagaatctgcgctggagaaaggacatgacg
cactggcggcagaacacagagaagcttgacaagtcaagagcagagatagaacatgaagca
ctgatcgatgggaacctggctactgaagcaaacctcatcatcttagacacactggagatt
gttgtccagactgtttctgtaacagaatccaaagagagcattctgggtggggtgctgaaa
gtgcttctgcagagcatggcctgcaaccagagtgcagtgtatctgcaacactgctttgcc
acgcagagagccctcgtctcaaagtttcctgagctcttgtttgaggaggagacagagcag
tgcgcagacttgtgcctccggctcctccgacactgcagcagcagcatcagcacgatccgc
tcacacgccagtgcctccctttacctcctcatgaggcagaactttgagatcgggaataac
tttgccagagtgaaaatgcaagtaacaatgtcactgtcctctttggtgggtacatctcag
aattttaatgaagaattcttaagacggtctctaaaaactattttgacgtatgctgaagaa
gatctagaattgagggaaacaacatttcctgatcaggtccaagatttggttttcaacctt
catatgatcctttctgacactgttaaaatgaaggaacaccaggaggaccccgaaatgctg
atcgacctcatgtacagaattgccaagggctaccagacctccccagacctgcgcctgacc
tggctgcagaacatggcgggcaagcactctgaacgaagcaaccacgctgaagccgcgcag
tgcctggtccactcggcagcccttgtcgccgagtacctgagcatgctggaagaccggaag
taccttcccgtggggtgtgtaacattccagaatatttcctctaatgtattagaagagtct
gctgtctcggatgatgtggtatctccagatgaagaaggtatttgctctggaaagtacttt
actgagtcagggctcgtggggttactggaacaagcggctgcttccttctccatggctggc
atgtacgaagcagttaatgaagtttacaaagtactcattcctattcatgaagctaatcgg
gatgcaaagaagctctccacaatccatggcaaacttcaggaagcgttcagcaagatcgtt
caccagagtactggctgggagcggatgtttggcacctatttccgtgttggcttttatggg
accaagttcggggacttggatgaacaggagtttatttacaaggagcctgcaataaccaaa
ctcgcagagatctctcacagactggaggggttttatggagaaagatttggcgaggatgtg
gttgaagtcatcaaggactccaatcctgtagacaagtgtaaattagaccccaacaaggcg
tacattcagatcacctacgtggagccgttctttgacacctacgagatgaaggacagagtc
acttactttgacaaaaattacaacctccgccgcttcgtgtactgcacccccttcacgcta
gacgggcgcgcccacggggggctccgcgagcagcgcaagcgcaaggcccttctgaccacg
tctcacgccttcccctacatcaaaaccagggtccacgtcacccacaaggaagagatcatc
ttaacaccaattgaagttgccatcgaagacatgcagaagaagactcaggaactggcgttt
gcgacacatcaagacccagcagaccccaaaatgctccagatggttctccagggatccgta
ggcaccactgtgaaccagggacctctggaggttgcccaggtcttcctgtctgaaatacct
ggtgacccaaagctcttcagacatcacaacaagctgcgcctttgcttcaaggactttact
aaaaggtgtgaggatgccttaagaaaaaataaaagcttaatcgggccagatcaaaaggag
tatcaaagagaactggagaggaactaccatcgccttaaagaggctctgcagccactgata
aacaggaaaatccctcagctctacaaggctgtgctgcctgtcacttgccacagagattcc
ttcagccgaatgagccttcgaaaaatggaactctag

DBGET integrated database retrieval system