KEGG   Meriones unguiculatus (Mongolian gerbil): 110564632Help
Entry
110564632         CDS       T05884                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04020  Calcium signaling pathway
mun04713  Circadian entrainment
mun04925  Aldosterone synthesis and secretion
mun04927  Cortisol synthesis and secretion
mun04929  GnRH secretion
mun04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110564632
   04020 Calcium signaling pathway
    110564632
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110564632
   04925 Aldosterone synthesis and secretion
    110564632
   04927 Cortisol synthesis and secretion
    110564632
  09159 Environmental adaptation
   04713 Circadian entrainment
    110564632
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110564632
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mun04040]
    110564632
Ion channels [BR:mun04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110564632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 110564632
NCBI-ProteinID: XP_021517814
Position
Unknown
AA seq 245 aa AA seqDB search
MADSSVPPSSAAAPAPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDVPHPDLAPVAFFCL
RQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFI
FIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRV
LRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLE
ENFTM
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagctctgtaccaccctcatccgcagcagccccggctcctgagccaggaatc
actgagcagccggggccccggagtccccctccgtcccctccaggcctggaggagccactg
gatggaaccaaccctgatgtcccacacccggacctggcgcctgttgccttcttctgcctg
cgccagaccacgagcccacggaactggtgcatcaagatggtatgtaacccatggttcgag
tgtgtgagcatgctggtcatcctgctgaactgtgtgaccctgggcatgtaccagccatgt
gacgacatggagtgcctgtcagaccgctgcaagatcctgcaggtctttgacgacttcatc
ttcatcttcttcgcgatggagatggtgcttaagatggtggccctgggcatttttggcaag
aagtgctacctcggggacacatggaaccgtctggattttttcattgtcatggcagggatg
gtcgagtactctctggacctacagaacatcaacctgtcagccatccgcactgtgcgtgtc
ctgaggcccctcaaagccatcaaccgtgtacccagcatgcggatcctggtgaacctgttg
cttgacaccctgcccatgctgggaaacgtgctcctgctctgtttcttcgtcttcttcatc
ttcggcatcattggcgtgcagctttgggcaggcctgctgcggaaccgctgcttcctggag
gagaacttcaccatgtga

DBGET integrated database retrieval system